Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA2)

Shipped with Ice Packs
In Stock

Description

Role in Photosystem II

The D1 protein encoded by psbA2 forms the catalytic core of PSII, coordinating the Mn4_4CaO5_5 cluster responsible for water oxidation . Key structural features include:

  • Ligand-binding residues: Critical for stabilizing chlorophyll, pheophytin, and plastoquinone cofactors .

  • Redox regulation: Thiol redox states modulate psbA2 expression under high light, independent of plastoquinone pool redox status .

Isoform-Specific Adaptations

  • Stress response: In Synechococcus 7942, psbAII/III (encoding D1:2) replaces psbAI (D1:1) under high light, enhancing PSII photoinactivation resistance .

  • Catalytic tuning: Substitutions like C144P and P173M in PsbA2 alter TyrZ_Z hydrogen bonding, affecting electron transfer kinetics in Thermosynechococcus elongatus .

Research Applications

Recombinant psbA2 is widely used for:

  1. Mechanistic studies of PSII photodamage and repair cycles .

  2. ELISA-based assays to quantify D1 protein turnover under oxidative stress .

  3. Structural biology: Crystallographic analysis of PSII complexes to map cofactor interactions .

Regulatory and Evolutionary Context

  • Gene regulation: AT-rich sequences upstream of psbA2 influence transcription, while CmpR protein binding enhances expression under low-CO2_2 conditions .

  • Evolutionary significance: Nitrogen-fixing cyanobacteria like Cyanothece 51142 express atypical psbA4 at night to suppress water oxidation, enabling oxygen-sensitive nitrogenase activity .

Technical Considerations for Use

  • Reconstitution: Requires dilution in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

  • Storage: Prolonged freeze-thaw cycles degrade protein integrity; aliquot recommended .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. For specific delivery time information, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize the development of that specified tag.
Synonyms
psbA2; sync_1856; Photosystem II protein D1 2; PSII D1 protein 2; Photosystem II Q(B protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Synechococcus sp. (strain CC9311)
Target Names
psbA2
Target Protein Sequence
MTTTIQQRSGANGWQQFCDWVTSTNNRLYVGWFGVLMIPTLLAATTCFIVAFIAAPPVDI DGIREPVAGSLMYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPFQLVVFHFL IGIYAYMGREWELSYRLGMRPWICVAYSAPVAAASAVFLVYPFGQGSFSDAMPLGISGTF NYMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGVSTMAFNLNGF NFNQSILDGQGRVLNTWADVLNRAGLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient that subsequently drives ATP formation. PSII consists of a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbA2 gene and what protein does it encode in Synechococcus sp.?

The psbA2 gene in Synechococcus sp. encodes the D1 protein, also known as Photosystem Q(B) protein 2, which is a core component of Photosystem II (PSII). This protein forms part of the reaction center in PSII and is crucial for photosynthetic electron transfer. The D1 protein binds many of the redox-active cofactors necessary for PSII function and plays a central role in the water-splitting process of oxygenic photosynthesis . Under normal growth conditions, psbA2 is constitutively expressed and accounts for approximately 95% of total psbA transcripts in species like Synechocystis .

How many copies of the psbA gene are present in Synechococcus genomes?

Synechococcus species contain multiple copies of the psbA gene, with considerable variation across strains. Genomic analysis of 11 marine Synechococcus strains revealed that they possess between three to six psbA copies per genome . Typically, one gene encodes the D1:1 isoform while the others encode the D1:2 isoform. For example, in Synechococcus sp. WH7803, three psbA genes encode identical D1:2 isoforms . In the freshwater strain Synechocystis sp. PCC 6803, three copies of the psbA gene exist (psbA1, psbA2, and psbA3) .

What are the functional differences between D1:1 and D1:2 isoforms?

The D1:1 and D1:2 isoforms differ in their response to environmental stress and photochemical properties. Under normal growth conditions, the D1:1 isoform predominates, but under various stress conditions (such as high light or UV radiation), there is a shift toward expression of the D1:2 isoform . This isoform exchange alters PSII photochemistry and represents an adaptation mechanism. The D1:2 isoform appears to provide enhanced tolerance to stress conditions, as evidenced by studies showing that high light-acclimated cells (with higher D1:2 expression) are more resistant to UV light than low light-acclimated cells . The structural differences between these isoforms affect electron transfer between the primary quinone acceptor QA and the secondary quinone acceptor QB, as demonstrated in mutagenesis studies .

How does environmental stress affect psbA gene expression in Synechococcus sp.?

Environmental stressors dramatically alter the expression patterns of psbA genes in Synechococcus sp. Both high light (HL) and ultraviolet (UV) radiation induce the expression of psbA genes encoding the D1:2 isoform while simultaneously repressing the psbA gene encoding the D1:1 isoform . Interestingly, despite having multiple psbA genes encoding identical D1:2 isoforms, only one is strongly stress-responsive under experimental conditions, suggesting specialized regulatory mechanisms for different gene copies . Additionally, low-oxygen conditions can induce the expression of normally cryptic psbA genes. For instance, in Synechocystis, the psbA1 gene, which is virtually silent under aerobic conditions, shows increased transcription under low-oxygen conditions, with detectable D1 protein appearing after 5 hours in low-oxygen environments .

ConditionpsbA1 ExpressionpsbA2 ExpressionpsbA3 ExpressionPredominant Isoform
Normal (aerobic)Minimal/None~95% of transcripts~5% of transcriptsD1:1
High LightMinimal/NoneDecreasedIncreasedD1:2
UV RadiationMinimal/NoneDecreasedIncreasedD1:2
Low OxygenInducedVaries by speciesVaries by speciesSpecies-dependent

What regulatory mechanisms control psbA2 gene expression in Synechococcus sp.?

The regulation of psbA2 gene expression involves multiple layers of control at both transcriptional and post-transcriptional levels. At the transcriptional level, expression responds to environmental factors such as light intensity and quality, with high light inducing changes in expression patterns between different psbA genes . At the post-transcriptional level, antisense RNAs play a crucial role. Two short antisense RNAs (asRNAs), PsbA2R and PsbA3R, originating from the 5' untranslated region (UTR) of genes psbA2 and psbA3, have been identified as regulatory elements .

Despite their relatively low abundance, these asRNAs significantly impact gene expression. Studies with PsbA2R suppressor mutants showed approximately 50% reduction in psbA2 mRNA levels compared to control strains, accompanied by 15% lower photosystem II activity and reduced D1 protein amounts . The mechanism appears to involve PsbA2R protection of psbA2 mRNA from RNase E degradation, particularly when both the AU box and the ribosome-binding site in the 5' UTR of psbA2 mRNA are covered by the asRNA . This highlights the importance of RNA-based regulation in achieving maximal D1 synthesis levels.

What is the evolutionary significance of multiple psbA gene copies in marine Synechococcus?

The evolutionary dynamics of psbA genes in marine Synechococcus reveal interesting patterns that suggest adaptive significance for multiple gene copies. Phylogenetic analyses show that genes encoding D1:1 isoforms from different marine Synechococcus strains cluster together, indicating evolutionary conservation of this isoform across species . In contrast, genes encoding D1:2 isoforms tend to group by genome into subclusters, suggesting lineage-specific evolution .

Examination of the genomic environment of psbA genes indicates that D1:2-encoding genes are hotspots for DNA recombination . This observation, combined with evidence for concerted evolution of all psbA genes within each genome, suggests that D1:2 coding genes are subject to intragenome homogenization, likely mediated by gene conversion mechanisms . This evolutionary pattern may facilitate rapid adaptation to changing environmental conditions, allowing marine Synechococcus to optimize photosynthetic efficiency under various stress conditions. The maintenance of multiple gene copies also provides redundancy and opportunities for specialized expression patterns in response to different environmental cues.

How do antisense RNAs (PsbA2R and PsbA3R) regulate psbA2 and psbA3 gene expression?

Antisense RNAs PsbA2R and PsbA3R represent a sophisticated regulatory mechanism controlling psbA gene expression. These short asRNAs originate from the 5' untranslated region (UTR) of the psbA2 and psbA3 genes in Synechocystis sp. PCC 6803 . Despite their low steady-state abundance, they significantly impact gene expression. PsbA2R acts as a positive regulator of psbA2 expression and influences cell growth on solid medium .

The molecular mechanism involves protection of psbA2 mRNA from degradation. When PsbA2R covers both the AU box and the ribosome-binding site in the 5' UTR of psbA2 mRNA, it protects the mRNA from RNase E-mediated degradation . Experimental evidence supports this protective role:

  • Suppressor mutants with reduced PsbA2R levels (PsbA2R(-)) show approximately 50% reduction in psbA2 mRNA compared to control strains.

  • These mutants exhibit 15% lower photosystem II activity and reduced D1 protein levels.

  • In vitro RNase E assays demonstrate the stabilizing effect of PsbA2R on psbA2 mRNA .

The regulatory dynamics also include differential responses to light conditions. Under high light, both psbA2 mRNA and PsbA2R levels initially increase, followed by different degradation patterns depending on light conditions and the presence of transcription inhibitors like rifampicin . This complex interplay adds another layer to the regulatory mechanisms that optimize D1 synthesis under varying environmental conditions.

What techniques are available for targeted mutagenesis of the psbA2 gene?

Several sophisticated techniques have been developed for targeted mutagenesis of the psbA2 gene, particularly in model organisms like Synechocystis sp. PCC 6803. One advanced approach involves creating a triple deletion strain in which psbA1 and psbA3 are removed by markerless deletions while psbA2 is replaced by a chloramphenicol-resistance cassette . This is followed by reintroduction of a modified psbA2 gene using a vector with a kanamycin-resistance cassette as a selectable marker .

This system offers several advantages:

  • It allows introduction of mutations into the constitutively expressed psbA2 copy without affecting the expression of any flanking genes.

  • The use of markerless deletions minimizes potential effects on genome function.

  • The approach facilitates comparative studies between wild-type and mutant D1 proteins.

Using this technique, researchers have successfully generated mutant strains with amino acid substitutions at specific positions, such as D1-Glu244 replaced by His or Asp, to study the functional importance of these residues in plastoquinone binding and protonation . The system has demonstrated that while some mutations (like E244H) significantly impair oxygen evolution and electron transfer between QA and QB, others (like E244D) result in phenotypes more closely resembling the control strain . This highlights the utility of targeted mutagenesis in dissecting structure-function relationships in the D1 protein.

What experimental approaches can measure PSII activity in psbA2 mutants?

Assessing PSII activity in psbA2 mutants requires a combination of biophysical, biochemical, and spectroscopic techniques. Based on established research protocols, the following approaches are recommended:

  • Oxygen Evolution Measurements:

    • Clark-type oxygen electrode measurements to quantify PSII-mediated O₂ production

    • Compare oxygen evolution rates between wild-type and mutant strains under various light intensities

    • Use specific electron acceptors like p-benzoquinone to isolate PSII activity

  • Chlorophyll Fluorescence Analysis:

    • Pulse Amplitude Modulation (PAM) fluorometry to measure PSII quantum yield

    • 77K fluorescence spectroscopy to assess the integrity of PSII complexes

    • Fast fluorescence induction kinetics to characterize electron transfer efficiency between QA and QB

  • Electron Transfer Kinetics:

    • Flash-induced absorbance changes at specific wavelengths (e.g., 320 nm) to monitor electron transfer between QA and QB

    • Decay kinetics analysis to determine the proportion of QB-reducing versus non-reducing centers

    • Temperature dependence studies to assess activation energies for electron transfer steps

  • Protein Quantification:

    • Western blot analysis using D1-specific antibodies to quantify D1 protein levels

    • Normalize to other PSII subunits or total protein content

    • Monitor D1 turnover rates under photoinhibitory conditions

  • Gene Expression Analysis:

    • RT-PCR or RNA-Seq to quantify psbA transcript levels

    • Compare expression patterns under different environmental conditions (light intensity, spectral quality, oxygen levels)

    • Correlate transcript abundance with protein levels and PSII activity

These methodologies provide complementary information about the impact of psbA2 mutations on PSII structure and function, enabling comprehensive characterization of the mutant phenotypes.

How should experiments be designed to study stress responses in the psbA gene family?

Designing experiments to study stress responses in the psbA gene family requires careful consideration of environmental conditions, temporal dynamics, and analytical methods. Based on established research protocols, the following experimental design is recommended:

  • Acclimation Phase:

    • Grow cultures under defined standard conditions to establish baseline physiology

    • Acclimate separate cultures to different growth irradiances (low, medium, high) for comparative studies

    • Ensure all cultures are in similar growth phases before stress application

  • Stress Application Protocol:

    • Light Stress: Apply high light (HL) treatments of defined intensity and duration

    • UV Radiation: Use calibrated UV sources with specified wavelength ranges and fluence rates

    • Oxygen Limitation: Create controlled low-oxygen environments using gas-tight chambers with defined O₂ levels

    • Include appropriate control conditions for each stress factor

  • Time-Course Sampling:

    • Collect samples at multiple time points (e.g., 0, 1, 3, 5, 10 hours) to capture the dynamics of response

    • Process samples consistently to minimize technical variability

    • Consider parallel analyses of transcripts, proteins, and physiological parameters

  • Transcriptional Analysis:

    • Use gene-specific primers for RT-PCR to distinguish between different psbA gene transcripts

    • Quantify relative expression levels using real-time PCR with appropriate reference genes

    • Consider RNA stability assessments using transcription inhibitors like rifampicin

  • Protein Analysis:

    • Monitor D1 protein levels using Western blots with D1-specific antibodies

    • Assess D1 turnover rates under stress conditions

    • Correlate protein abundance with transcript levels and photosynthetic activity

  • Photosystem II Activity Measurements:

    • Measure PSII quantum yield using PAM fluorometry before, during, and after stress application

    • Assess oxygen evolution capacity using Clark-type electrodes

    • Perform 77K fluorescence spectroscopy to evaluate PSII complex integrity

This comprehensive approach enables researchers to distinguish between transcriptional, translational, and post-translational responses in the psbA gene family under various stress conditions.

How should researchers interpret changes in D1 protein levels under stress conditions?

Interpreting changes in D1 protein levels under stress conditions requires careful consideration of multiple factors affecting D1 synthesis, degradation, and isoform switching. The following framework helps in data analysis and interpretation:

  • Establish a Comprehensive Timeline:

    • Compare D1 protein levels, psbA transcript levels, and PSII activity at multiple time points

    • Determine the sequence of molecular events following stress application

    • Distinguish between immediate responses and acclimation processes

  • Consider Differential Gene Expression:

    • Analyze expression patterns of different psbA genes (psbA1, psbA2, psbA3)

    • Note that under high light or UV stress, psbA genes encoding D1:2 are induced while those encoding D1:1 are repressed

    • In low-oxygen conditions, normally cryptic psbA genes may be activated

  • Account for D1 Turnover Dynamics:

    • D1 protein has one of the highest turnover rates among photosynthetic proteins

    • Under stress conditions, degradation rates may increase while synthesis rates change

    • Net D1 protein levels reflect the balance between synthesis and degradation

  • Interpret Isoform Switching Effects:

    • A shift from D1:1 to D1:2 isoforms typically indicates stress acclimation

    • High light-acclimated cells (with more D1:2) show greater resistance to UV stress

    • Altered D1 isoform composition affects electron transfer properties between QA and QB

  • Consider Regulatory Factors:

    • Antisense RNAs like PsbA2R positively regulate psbA2 expression

    • Suppression of these regulatory RNAs can reduce D1 protein levels by ~15%

    • Post-transcriptional regulation may cause discrepancies between mRNA and protein levels

  • Normalization and Controls:

    • Normalize D1 protein levels to appropriate internal standards

    • Compare stressed samples to both untreated controls and acclimated controls

    • Consider potential effects on other PSII components

When interpreting data, it's essential to recognize that changes in D1 protein levels may represent either adaptive responses to maintain photosynthetic function or damage-induced impairment, depending on the specific stress conditions and physiological context.

What control experiments are essential when studying psbA2 function?

When studying psbA2 function, well-designed control experiments are crucial for valid data interpretation. The following control experiments should be considered essential:

  • Genetic Controls:

    • Wild-type reference: Include the unmodified parental strain as a positive control

    • Gene deletion controls: Use strains with specific psbA gene deletions (ΔpsbA1, ΔpsbA3) to isolate psbA2 function

    • Complementation controls: Reintroduce wild-type psbA2 into deletion mutants to confirm phenotype rescue

    • Vector-only controls: Include strains transformed with empty vectors to account for transformation effects

  • Expression Verification:

    • Transcript analysis: Verify psbA gene expression patterns using RT-PCR or RNA-Seq

    • Protein verification: Confirm D1 protein levels via Western blot analysis

    • Localization controls: Verify proper integration of D1 protein into thylakoid membranes

    • Targeted mutation controls: For point mutations, include conservative substitutions (e.g., E244D) alongside non-conservative ones (e.g., E244H)

  • Physiological Controls:

    • Growth phase standardization: Ensure all strains are in comparable growth phases

    • Pre-acclimation controls: Acclimate cultures to specific conditions before experiments

    • Recovery experiments: Allow stressed cells to recover to distinguish between damage and regulation

    • Dose-response tests: Apply varying intensities of stress to establish thresholds

  • Experimental Validation:

    • Technical replicates: Perform multiple independent measurements

    • Biological replicates: Use different culture batches grown separately

    • Method validation: Apply multiple techniques to measure the same parameter

    • Alternative stress conditions: Compare responses to different stressors that affect D1 function

  • Inhibitor Studies:

    • Transcription inhibitors: Use rifampicin to distinguish between transcriptional regulation and mRNA stability

    • Translation inhibitors: Apply chloramphenicol or lincomycin to assess protein turnover

    • Electron transport inhibitors: Use DCMU or other specific inhibitors to isolate components of the photosynthetic electron transport chain

    • Control for inhibitor side effects: Include appropriate vehicle controls

These control experiments collectively ensure that observed phenotypes are specifically attributed to psbA2 function rather than experimental artifacts or secondary effects, strengthening the validity and reproducibility of research findings.

What are the future research directions for psbA2 studies in Synechococcus sp.?

Future research on psbA2 in Synechococcus sp. shows promise for advancing our understanding of photosynthetic adaptation mechanisms and potentially developing biotechnological applications. Several compelling research directions emerge from current knowledge:

  • Structural Biology Approaches:

    • Determine high-resolution structures of different D1 isoforms to clarify structure-function relationships

    • Apply cryo-EM techniques to visualize D1 protein in the context of the complete PSII complex

    • Use molecular dynamics simulations to understand how specific amino acid substitutions affect electron transfer dynamics

  • Regulatory Network Exploration:

    • Further characterize the roles of antisense RNAs in regulating psbA gene expression

    • Identify transcription factors and cis-regulatory elements controlling differential psbA gene expression

    • Map the complete post-transcriptional regulatory network involving psbA mRNAs

  • Environmental Adaptation Mechanisms:

    • Investigate how different Synechococcus ecotypes have optimized their psbA gene families for specific environmental niches

    • Examine psbA gene expression patterns under multiple simultaneous stressors (e.g., high light + temperature + nutrient limitation)

    • Determine the adaptive significance of psbA gene copy number variation across species

  • Synthetic Biology Applications:

    • Engineer D1 proteins with enhanced stress resistance or modified spectral properties

    • Develop synthetic regulatory circuits controlling psbA expression for optimized photosynthetic efficiency

    • Create minimal photosynthetic systems using engineered D1 variants

  • Evolution and Comparative Genomics:

    • Expand phylogenetic analyses of psbA genes across diverse cyanobacterial lineages

    • Investigate the evolutionary dynamics of gene conversion and recombination in the psbA gene family

    • Determine how horizontal gene transfer may have shaped psbA gene diversity

  • System-Level Integration:

    • Develop mathematical models of D1 turnover and PSII repair cycle

    • Integrate transcriptomic, proteomic, and metabolomic data to build comprehensive models of photosynthetic adaptation

    • Connect psbA regulation to broader cellular responses to environmental stress

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.