Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
psbA3; Syncc9605_1042; Photosystem II protein D1 2; PSII D1 protein 2; Photosystem II Q(B protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Synechococcus sp. (strain CC9605)
Target Names
psbA3
Target Protein Sequence
MSTAIRSGRQSNWEAFCQWVTDTNNRIYVGWFGVLMIPCLLAATICFTIAFIAAPPVDID GIREPVAGSLIYGNNIISGAVIPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVCFHFLI GISAYMGRQWELSYRLGMRPWICVAYSAPLSAAMAVFLVYPFGQGSFSDGMPLGISGTFN FMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEAESQNYGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVVGIWFTSMGISTMAFNLNGFN FNQSILDSQGRVLNTWADVLNRANLGMEVQHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently utilized for ATP formation. It comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of psbA3 and how does it compare to other D1 protein variants?

The psbA3 gene encodes a D1 protein isoform that is integral to Photosystem II function in Synechococcus sp. The full-length protein consists of 343 amino acids with the following sequence:

MSTAIRSGRQSNWEAFCQWVTDTNNRIYVGWFGVLMIPCLLAATICFTIAFIAAPPVDIDGIREPVAGSLIYGNNIISGAVIPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVCFHFLIGISAYMGRQWELSYRLGMRPWICVAYSAPLSAAMAVFLVYPFGQGSFSDGMPLGISGTFNFMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEAESQNYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVVGIWFTSMGISTMAFNLNGFNFNQSILDSQGRVLNTWADVLNRANLGMEVQHERNAHNFPLDLA

In Synechococcus sp. 7942, there are three psbA genes encoding two distinct D1 protein isoforms: D1:1 (encoded by psbAI) and D1:2 (encoded by psbAII and psbAIII). In contrast, Synechocystis sp. has both psbA2 and psbA3 genes encoding the same D1m protein isoform under normal conditions, with an additional psbA1 gene that expresses under anaerobic conditions .

How does the expression pattern of psbA3 vary under different environmental conditions?

The expression of psbA genes is highly regulated by environmental factors, particularly light intensity. Under normal growth conditions (approximately 50 μmol photons m^-2 s^-1), psbA3 contributes to only 3-10% of the total psbA transcript pool in Synechocystis sp., while psbA2 accounts for approximately 90% .

When cells are exposed to high light conditions, transcription of both psbA2 and psbA3 increases significantly. This light-dependent regulation occurs at the transcriptional level and is not affected by the addition of electron transfer inhibitors . The promoter regions of psbA2 and psbA3 share identical -35 elements, which likely contributes to their similar regulation patterns, though their transcription start points differ (-49 and -88 relative to ATG, respectively) .

What is the functional significance of the QB binding site in Photosystem II?

The QB binding site in Photosystem II serves as the location where the exchangeable plastoquinone (PQ) accepts electrons and becomes reduced to plastohydroquinone (PQH2), which is subsequently released into the membrane. This process is fundamental to photosynthetic electron transport.

Recent research has determined the midpoint potentials (E) of QB in Photosystem II from Thermosynechococcus elongatus:

  • E(QB/QB^- −) ≈ 90 mV

  • E(QB^- −/QBH2) ≈ 40 mV

These values reveal several important functional characteristics:

  • The semiquinone form (QB^- −) is thermodynamically stabilized

  • The difference between E(QB/QBH2) (~65 mV) and E(PQ/PQH2) (~117 mV) provides the driving force (~50 meV) for QBH2 release into the membrane pool

  • PQ binds approximately 50 times more tightly than PQH2 to the QB site

What is the most effective expression system for producing functional recombinant psbA3 protein?

Based on current research practices, E. coli has been successfully employed for the heterologous expression of recombinant Synechococcus sp. psbA3 protein. The recommended approach involves expression with an N-terminal His-tag to facilitate purification while maintaining protein function .

For optimal expression:

  • Use an E. coli strain optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3))

  • Express the protein with an N-terminal His-tag for purification

  • Optimize growth temperature, typically 18-25°C to prevent inclusion body formation

  • Induce expression with low concentrations of IPTG (0.1-0.5 mM)

  • Include membrane-stabilizing agents in the growth medium

What purification strategy yields the highest purity and functional integrity for recombinant psbA3?

A multi-step purification protocol is recommended:

  • Cell lysis: Use gentle lysis methods such as enzymatic lysis with lysozyme followed by mild sonication in the presence of protease inhibitors.

  • Membrane solubilization: Solubilize the membrane fraction with a suitable detergent (e.g., n-dodecyl-β-D-maltoside (DDM) at 1-2%) in a buffer containing stabilizing agents.

  • Affinity chromatography: Purify using Ni-NTA resin exploiting the His-tag:

    • Binding buffer: 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.05% DDM

    • Wash buffer: Binding buffer plus 20-40 mM imidazole

    • Elution buffer: Binding buffer plus 250-300 mM imidazole

  • Size exclusion chromatography: Further purify using a Superdex 200 column to separate aggregates and ensure homogeneity.

  • Final preparation: Store the purified protein in a buffer containing 6% trehalose at pH 8.0 to maintain stability. Aliquot and store at -20°C/-80°C, avoiding repeated freeze-thaw cycles .

How can researchers verify the structural integrity and functional activity of purified recombinant psbA3?

Multiple complementary techniques should be employed:

  • SDS-PAGE and Western blotting: Confirm protein size and purity (>90% recommended) .

  • Circular dichroism (CD) spectroscopy: Assess secondary structure integrity, particularly the alpha-helical content characteristic of membrane proteins.

  • Electron paramagnetic resonance (EPR) spectroscopy: Evaluate the functional integrity of the QB binding site by measuring the formation and stability of the semiquinone (QB^- −) radical. This method has been successfully used to determine redox potentials of QB in PSII .

  • Electron transfer kinetics: Measure the rate of electron transfer from QA^- − to QB using time-resolved spectroscopy.

  • Thermoluminescence measurements: Assess the energy gap between QA^- − and QB, which provides insights into electron transfer capabilities .

How can site-directed mutagenesis be applied to investigate structure-function relationships in psbA3?

Site-directed mutagenesis of psbA3 provides valuable insights into amino acid residues critical for QB binding and function. A methodological approach includes:

  • Target selection:

    • Residues directly involved in QB binding

    • Residues in the proton transfer pathway

    • Amino acids that differ between D1:1 and D1:2 variants

  • Mutagenesis protocol:

    • Use PCR-based methods with mutagenic primers

    • Clone into an appropriate expression vector with the His-tag

    • Verify mutations by DNA sequencing

  • Functional characterization:

    • Measure shifts in QB/QB^- − and QB^- −/QBH2 redox potentials using EPR

    • Assess electron transfer rates between QA^- − and QB

    • Evaluate proton transfer efficiency

  • Comparative analysis:

    • Correlate structural changes with altered function

    • Compare with data from other D1 variants (e.g., D1:1 vs. D1:2)

    • Develop structure-based models of QB binding and reduction

What approaches can elucidate the regulation of psbA3 gene expression under various stress conditions?

To investigate psbA3 gene regulation under different environmental stresses:

  • Transcriptional analysis:

    • Real-time qPCR to quantify psbA3 transcript levels relative to housekeeping genes

    • RNA-seq for genome-wide expression profiling

    • S1 nuclease protection assays to map transcription start sites

  • Promoter analysis:

    • Create reporter gene constructs (e.g., luciferase) fused to the psbA3 promoter

    • Perform 5' deletion analysis to identify key regulatory elements

    • Use electrophoretic mobility shift assays (EMSA) to identify proteins binding to regulatory elements

  • Experimental stress conditions to test:

    • High light (750 μmol photons m^-2 s^-1 vs. normal 50 μmol photons m^-2 s^-1)

    • Temperature extremes (heat and cold shock)

    • Nutrient limitation (particularly iron and nitrogen)

    • Oxidative stress induced by methyl viologen or hydrogen peroxide

  • Chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the psbA3 promoter under different conditions.

How does QB energetics in Synechococcus sp. compare with other cyanobacterial species and what are the functional implications?

A comparative analysis of QB energetics:

  • Methodological approach:

    • Express recombinant psbA3 from multiple cyanobacterial species

    • Measure redox potentials using EPR spectroscopy under identical conditions

    • Perform thermoluminescence measurements to assess energy gaps

  • Comparative data:

    • In Thermosynechococcus elongatus, E(QB/QB^- −) ≈ 90 mV and E(QB^- −/QBH2) ≈ 40 mV

    • The difference between E(QB/QB^- −) and E(QA/QA^- −) is approximately 234 meV, representing the thermodynamic driving force for electron transfer

    • Compare these values with those from Synechococcus sp. and other cyanobacteria

  • Functional implications:

    • Higher E(QB/QB^- −) values reduce the risk of back-reactions and electron leakage to O2

    • The thermodynamic favorability of QBH2 release optimizes PSII function when the plastoquinone pool is largely reduced

    • Species-specific differences may reflect evolutionary adaptations to different ecological niches

What are the critical factors affecting the stability of recombinant psbA3 protein during purification and storage?

Several key factors influence protein stability:

  • Buffer composition:

    • Maintain pH near 8.0 to prevent denaturation

    • Include 6% trehalose as a stabilizing agent

    • Use Tris/PBS-based buffer systems

  • Storage conditions:

    • Store at -20°C/-80°C for long-term preservation

    • Add 5-50% glycerol (recommended final concentration: 50%) before freezing

    • Aliquot to avoid repeated freeze-thaw cycles

  • Common stability issues and solutions:

IssuePossible CauseSolution
Protein aggregationDetergent concentration too lowIncrease detergent above CMC
Activity loss during storageFreeze-thaw damageAdd glycerol, store working aliquots at 4°C for up to one week
Precipitation during concentrationBuffer incompatibilityAdjust ionic strength, add stabilizing agents
Oxidative damageReactive oxygen speciesInclude reducing agents (e.g., DTT, β-mercaptoethanol)

How can researchers distinguish between effects on QB binding versus effects on electron transfer in experimental studies?

To discriminate between binding and electron transfer effects:

  • Binding studies:

    • Use isothermal titration calorimetry (ITC) to measure binding affinities

    • Employ competitive binding assays with labeled quinones

    • Perform equilibrium dialysis with radioactive or fluorescent quinone analogs

  • Electron transfer kinetics:

    • Use time-resolved spectroscopy to measure electron transfer rates

    • Perform flash-induced absorbance changes at 320 nm (QA reduction) and 450 nm (QB reduction)

    • Measure thermoluminescence to assess energy gaps between electron transfer components

  • Distinguishing experimental approach:

    • If a mutation affects binding but not electron transfer: Expect changes in binding affinity without alterations in electron transfer rate constants when normalized for occupancy

    • If a mutation affects electron transfer but not binding: Expect normal binding parameters but altered electron transfer kinetics

    • If both are affected: Combine binding studies with electron transfer measurements to deconvolute the effects

What emerging technologies might advance our understanding of psbA3 protein dynamics and function?

Several cutting-edge approaches show promise:

  • Cryo-electron microscopy (cryo-EM):

    • Capture conformational changes during the QB reduction cycle

    • Visualize protein-quinone interactions at near-atomic resolution

    • Compare structures with different quinone analogs bound

  • Time-resolved serial femtosecond crystallography:

    • Observe structural changes during electron transfer in real-time

    • Track proton movement during QB reduction

    • Identify transient intermediate states

  • Advanced spectroscopic techniques:

    • 2D electronic spectroscopy to probe energy transfer

    • Time-resolved EPR to follow radical pair dynamics

    • Fourier transform infrared (FTIR) difference spectroscopy to monitor protein and cofactor changes during electron transfer

  • Computational approaches:

    • Molecular dynamics simulations of quinone binding and movement

    • Quantum mechanical/molecular mechanical (QM/MM) calculations of electron transfer parameters

    • Machine learning for predicting mutation effects on function

How might understanding psbA3 and QB energetics contribute to designing more efficient artificial photosynthetic systems?

The natural optimization of QB energetics provides valuable insights for synthetic systems:

  • Design principles derived from natural systems:

    • Tune redox potentials to minimize back-reactions (E(QB/QB^- −) ≈ 90 mV)

    • Create appropriate driving forces for electron transfer (~234 meV gap between QA/QA^- − and QB/QB^- −)

    • Engineer differential binding affinities for oxidized versus reduced forms

  • Applications in artificial photosynthesis:

    • Design synthetic protein scaffolds with optimized quinone binding pockets

    • Create biomimetic catalysts based on QB site architecture

    • Develop hybrid biological-artificial systems incorporating engineered psbA3 variants

  • Performance metrics to target:

    • Maximize quantum yield of charge separation

    • Minimize energy losses during electron transfer

    • Enhance stability against photodamage

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.