Recombinant Synechococcus sp. Photosystem Q (B) protein 3

Shipped with Ice Packs
In Stock

Description

Core Functions

  1. Q(B) Binding and Energy Transfer:

    • PsbA3 stabilizes the Q(B)-binding pocket, critical for electron transfer from plastosemiquinone to the acceptor side of PSII .

    • Structural studies reveal that the D–E loop of psbA3 undergoes conformational changes during Q(B) binding, influenced by Psb28 and bicarbonate .

  2. Interactions with PSII Subunits:

    • Binds to CP47 (a core subunit of PSII) via its N-terminal region, as shown in cryo-EM structures of monomeric PSII complexes .

    • Collaborates with PsbD (D2 protein) to form the heterodimeric PSII reaction center .

  3. Photoprotection and Stability:

    • Participates in the repair cycle of PSII under photoinhibitory conditions by maintaining structural integrity .

Functional Mutagenesis

  • PsbD(3)-Glu241 Mutants:

    • Replacing PsbD(3)-Glu241 with bicarbonate alters bicarbonate affinity and electron transfer kinetics, highlighting psbA3’s role in acceptor-side maturation .

Recombinant Synechococcus sp. Photosystem Q(B) protein 3 is indispensable for studying PSII assembly, energy transfer, and photoprotection. Its structural plasticity, particularly in the Q(B)-binding site, underscores its adaptability in diverse cyanobacterial strains. Commercial availability in high-purity forms enables precise biochemical and biophysical assays, advancing our understanding of oxygenic photosynthesis mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand that you may have specific requirements. If so, please indicate your preference when placing the order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
psbA3; SYNPCC7002_A2164; Photosystem II protein D1 3; PSII D1 protein 3; Photosystem II Q(B protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)
Target Names
psbA3
Target Protein Sequence
MTTLLQQQGSANLWERFCQWVTSTENRFYVGWFGVLMIPTLLTATICFILAFVAAPPVDI DGIREPVAGSLLYGNNIITAAVVPSSNAIGLHFYPIWDAANLDEWLYNGGPYQLIVFHFL LGIFSYMGREWELSYRLGMRPWIAVAYSAPVAAATAVLLVYSIGQGSFSDGLPLGISGTF NFMFVLQAEHNVLMHPFHMLGVAGVFGGALFSAMHGSLVTSSLIRETTETESQNSGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLAAWPVIGIWFASLAVACFAFNLNGF NFNQSLLDSQGRVINTWADILNRANLGIEAMHERNVHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient. This gradient is subsequently used for ATP formation. PSII comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Photosystem Q(B) protein 3 (PsbA3) in Synechococcus sp. and what is its function?

Photosystem Q(B) protein 3 (PsbA3) is a variant of the D1 protein found in Photosystem II (PSII) of Synechococcus species. The D1 protein, encoded by psbA genes, is a core component of the photosynthetic reaction center in PSII. PsbA3 plays a critical role in photosynthetic electron transport by binding to quinone molecules and facilitating electron transfer from the water-oxidation center to the plastoquinone pool. In Synechococcus sp., PsbA3 (1-344 amino acids) can be recombinantly expressed with tags such as N-terminal histidine tags in expression systems like E. coli .

The function of PsbA3 is intimately connected to the water-oxidation process, which is essential for oxygenic photosynthesis. Different variants of the PsbA protein can be expressed under varying environmental conditions, allowing these cyanobacteria to adapt to changing light and stress conditions.

How does PsbA3 relate to other components of cyanobacterial Photosystem II?

PsbA3 functions as part of a complex protein network within PSII. While PsbA3 forms part of the electron transport chain, other proteins like PsbQ serve complementary functions. Research has shown that PsbQ stabilizes the luminal components of cyanobacterial PSII, enhancing its activity and stability . Studies on Synechocystis 6803 demonstrated that PsbQ-tagged PSII retained more PsbV and manganese, resulting in higher activity and stability compared to other PSII complexes .

What experimental approaches are most effective for recombinant expression of PsbA3?

The recombinant expression of PsbA3 typically employs bacterial systems like E. coli with N-terminal histidine tags for purification purposes . Based on methodologies used for similar photosystem proteins, the following protocol represents an effective approach:

  • Gene cloning: The psbA3 gene from Synechococcus sp. can be cloned into expression vectors like pET series vectors that allow for inducible expression and incorporation of affinity tags.

  • Transformation and expression: The construct is introduced into E. coli strains optimized for protein expression (such as BL21(DE3)). Expression is typically induced with IPTG under controlled temperature conditions.

  • Protein purification: Histidine-tagged PsbA3 can be purified using nickel-nitrilotriacetic acid (Ni-NTA) agarose columns, with careful attention to buffer conditions that maintain protein stability .

For example, in related studies of photosystem proteins, researchers used an ÁKTA FPLC system with wash buffers containing compounds like 50 mM Mes–NaOH (pH 6.0), 5 mM CaCl₂, 10 mM MgCl₂, 25% glycerol, and 0.04% β-dodecylmaltoside. Elution was achieved using L-histidine-supplemented buffer, with peak fractions collected and concentrated .

How does PsbA3 contribute to environmental adaptation in Synechococcus?

PsbA3 plays a crucial role in allowing Synechococcus to adapt to varying environmental conditions, particularly different light regimes. In some cyanobacteria, specific psbA gene variants are upregulated in response to far-red light (FRL) conditions. During FRL photoacclimation, PSII undergoes significant modifications, including the replacement of certain chlorophyll a molecules with chlorophyll d and chlorophyll f molecules .

These modifications effectively lower the energy threshold required for photochemical catalysis of water oxidation, allowing the organisms to utilize lower-energy wavelengths of light (700-800 nm) for photosynthesis. The FRL-PSII complex contains FRL-specific core subunits that represent a significant adaptation to light-limited environments .

Recent structural studies at 2.25 Å resolution using cryo-EM have revealed that in FRL-acclimated Synechococcus sp. PCC 7335, the modified PSII contains one chlorophyll d molecule in the Chl D1 position of the electron transfer chain and four chlorophyll f molecules in the core antenna . These findings provide a structural basis for understanding how cyanobacteria can extend the range of photosynthetically active radiation they can utilize.

What is the relationship between PsbA3 and sulfide metabolism in Synechococcus?

Recent research has uncovered intriguing connections between photosynthesis and sulfide metabolism in cyanobacteria like Synechococcus. The Synechococcus sp. strain PCC7002 possesses sulfide:quinone oxidoreductase (SQR), which enables it to oxidize both endogenously produced and exogenous sulfide .

Sulfide can inhibit photosynthesis by binding to metalloproteins of PSII, including components of the electron transport chain where PsbA3 functions . The presence of SQR allows Synechococcus to detoxify sulfide and maintain photosynthetic efficiency. Mutants lacking SQR (Δsqr) showed altered expression of key photosynthesis genes and reduced competitive fitness compared to wild-type strains .

This relationship between sulfide metabolism and photosynthesis has significant implications for understanding how cyanobacteria like Synechococcus maintain productivity in sulfide-rich environments such as expanding oxygen minimum zones (OMZs) in marine ecosystems. Researchers studying PsbA3 should consider potential interactions with sulfide and SQR-mediated protective mechanisms when investigating photosynthetic performance.

How do transcriptional responses affect PsbA3 expression during phage infection?

Studies investigating the response of various Synechococcus strains to infection by cyanophages like the T4-like cyanomyovirus Syn9 have revealed complex transcriptional dynamics that could affect PsbA3 expression. While transcript levels for the majority of host genes decline shortly after infection, some genes display increased or stable transcript levels .

These host-response genes are highly host-specific and often located in hypervariable genomic islands, suggesting they represent part of the flexible genome of Synechococcus . Research has identified that genes involved in cell envelope maintenance, DNA repair, carbon fixation, respiration, and nutrient utilization may show altered expression patterns during infection.

For researchers studying PsbA3, it's important to consider how viral infection might alter expression patterns and potentially influence experimental results. Strategies for studying these effects might include:

  • Temporal transcriptomic analysis during infection

  • Comparative expression studies between infected and uninfected cultures

  • Identification of regulatory elements that control PsbA3 expression under stress conditions

What strategies can be employed for site-directed mutagenesis studies of PsbA3?

Site-directed mutagenesis of PsbA3 can provide valuable insights into structure-function relationships. Based on approaches used for similar photosystem proteins, researchers might consider the following methodology:

  • Design primers for specific amino acid substitutions, particularly targeting residues involved in quinone binding, electron transfer, or protein-protein interactions.

  • PCR-based mutagenesis using a template containing the wild-type psbA3 gene, followed by DpnI digestion to remove methylated template DNA.

  • Transformation of the mutagenized construct into cyanobacteria using targeted double homologous recombination, similar to methods employed for creating histidine-tagged variants in Synechocystis .

  • Verification of mutant segregation using PCR analysis to confirm complete replacement of wild-type copies with the mutant version, especially important given that cyanobacteria contain multiple genome copies per cell .

  • Functional characterization through oxygen evolution measurements, fluorescence analysis, and electron transport assays to assess the impact of specific mutations.

What analytical techniques are most effective for studying PsbA3 in assembled photosystem complexes?

Studying PsbA3 within assembled PSII complexes requires specialized techniques that preserve native interactions. Based on successful approaches in photosystem research, the following methods are recommended:

Isolation of intact PSII complexes:

  • Use strains with histidine-tagged PsbA3 or other PSII components (like CP47 or PsbQ) for affinity purification .

  • Solubilize membranes with mild detergents like β-dodecylmaltoside.

  • Perform affinity chromatography using Ni-NTA columns with careful buffer optimization.

Analytical techniques for characterization:

  • Oxygen evolution measurements to assess functional activity.

  • Blue native gel electrophoresis to analyze complex integrity and subunit composition.

  • Mass spectrometry to identify post-translational modifications and protein-protein interactions.

  • Cryo-electron microscopy for high-resolution structural analysis, as demonstrated by the 2.25 Å resolution structure of FRL-PSII .

The table below summarizes key analytical techniques and their applications for PsbA3 research:

TechniqueApplicationKey ParametersConsiderations
Oxygen EvolutionFunctional activityLight intensity, temperature, electron acceptorsRequires intact PSII complexes
Absorption SpectroscopyPigment analysis, redox changesWavelength range: 350-750 nmCan detect chlorophyll variants
Cryo-EMStructural analysisSample purity, vitrification conditionsResource-intensive but high resolution
Mass SpectrometrySubunit composition, PTMsIonization method, fragmentation patternMay require specialized sample prep
Fluorescence AnalysisEnergy transfer, assemblyExcitation/emission wavelengthsNon-destructive technique

How can researchers optimize growth conditions for studying PsbA3 variants under different light regimes?

Studying PsbA3 variants under different light conditions requires careful optimization of growth parameters. Based on protocols used in far-red light acclimation studies, researchers should consider the following approach:

  • Culture medium selection: ASNIII medium has been successfully used for Synechococcus cultures, with appropriate antibiotic selection for maintaining mutant strains (e.g., 50 μg kanamycin ml⁻¹) .

  • Stepwise light acclimation: When transitioning to specialized light conditions like far-red light (FRL), cultures should first be adapted to intermediate conditions. For example, cultures can be adapted to red light (~35-40 μmol photons m⁻² s⁻¹) before transfer to FRL .

  • Light source optimization: For FRL studies, light-emitting diode panels with emission centered at 720 nm or filtered halogen light can provide appropriate conditions (~20-28 μmol photons m⁻² s⁻¹) .

  • Long-term acclimation: Complete acclimation to altered light conditions may require extended growth periods. For FRL acclimation, cells require continuous growth with periodic dilution and medium refreshment over 8-12 weeks .

  • Gas composition control: Cultures should be sparged with controlled gas mixtures, such as 1% (v/v) CO₂ in air, to maintain consistent carbon availability .

  • Monitoring parameters: Regular measurements of optical density (typically at 750 nm), pigment composition, and gene expression patterns should be performed to track acclimation progress.

How can PsbA3 research contribute to understanding the limits of photosynthesis in extreme environments?

Research on PsbA3 and related photosystem components has significant implications for understanding photosynthetic limits in extreme environments. The discovery that far-red light acclimated Synechococcus can utilize wavelengths up to 800 nm challenges the traditionally accepted "red limit" of photosynthesis .

This adaptation involves the incorporation of different chlorophyll molecules (Chl d and Chl f) in place of Chl a, which effectively lowers the energy required to drive water oxidation. The specific positioning of these alternative chlorophylls, including one Chl d in the Chl D1 position of the electron transfer chain where PsbA3 functions, provides a structural basis for this expanded spectral range .

Understanding these adaptations could help predict how cyanobacterial communities might respond to changing light environments, including in deep water columns, under ice, or in soil microenvironments where far-red light predominates. Additionally, this research has implications for understanding potential photosynthetic mechanisms on other planets with different stellar radiation profiles.

What considerations are important when designing experiments to study PsbA3 response to oxidative stress?

When designing experiments to study PsbA3 response to oxidative stress, researchers should consider several important factors:

  • Stress induction methods: Controlled application of oxidative stressors such as hydrogen peroxide, methyl viologen, or high light intensities should be standardized and quantified.

  • Time-course analyses: Both short-term (minutes to hours) and long-term (days) responses should be monitored to distinguish between immediate protective responses and adaptive changes.

  • Protein turnover dynamics: PsbA3/D1 has one of the highest turnover rates among photosystem proteins due to its susceptibility to damage. Methods to quantify protein synthesis and degradation rates, such as pulse-chase labeling with isotopes, should be incorporated.

  • Comparative analysis: Experiments should include multiple Synechococcus strains or mutants with different PsbA variants to understand the specific contributions of PsbA3.

  • Multi-level analysis: Combining transcriptomic, proteomic, and physiological measurements will provide a comprehensive understanding of stress responses involving PsbA3.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.