Recombinant Synechococcus sp. Photosystem Q (B) protein 3 (psbA3)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant psbA3 is synthesized using heterologous expression systems:

Expression Platforms

  • Escherichia coli: Primary host for high-yield production (≥85% purity by SDS-PAGE) .

  • Cell-free systems: Alternative for rapid in vitro synthesis .

Role in Photosynthesis

  • Q<sub>B</sub> Binding: PsbA3-PSII exhibits faster Q<sub>B</sub>/plastoquinone exchange, enhancing oxygen evolution rates by 20–30% compared to PsbA1-PSII .

  • Stress Adaptation: Upregulated under high light (HL) and UV-B stress to replace photodamaged D1 proteins .

Mutational Studies

  • Q130E Mutation: Stabilizes hydrogen bonding with pheophytin, altering redox potential of Pheo D1 .

  • D1′ Isoform: Inactive in photoautotrophic growth when expressed as the sole D1 protein in Synechocystis 6803 mutants .

Experimental Uses

  • Photosynthesis Studies: Structural models resolve PSII dynamics at 1.9–2.1 Å resolution .

  • Herbicide Resistance Screening: Altered Q<sub>B</sub>-binding pockets in PsbA3 influence sensitivity to diuron and bromoxynil .

  • Biotechnological Engineering: Engineered PSII complexes for bioenergy applications .

Comparative Analysis of PsbA Isoforms

FeaturePsbA1PsbA2PsbA3
Expression ConditionsStandard lightModerate stressHigh light/UV stress
Q<sub>B</sub> ExchangeBaselineIntermediateEnhanced efficiency
Herbicide SensitivityHighModerateVariable

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, serving as a reference for your use.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA3; CYA_1811; Photosystem II protein D1 3; PSII D1 protein 3; Photosystem II Q(B protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)
Target Names
psbA3
Target Protein Sequence
MTTVIQRRSTSNVWEQFCEWVTSTDNRLYIGWFGVLMIPTLLTATTCFIIAFIGAPPVDI DGIREPVSGSLLYGNNIITGAVVPSSAAIGLHFYPIWEAASLDEWLYNGGPYQLIVLHFL IGVFCYMGREWELSYRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHQLGVAGVFGGALFSAMHGSLVTSSLIRETSEEESQNLGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGISIMAFNLNGF NFNQSIVDSNGRVVGTWADVLNRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H(2)O. This process generates O(2) and a proton gradient, which is subsequently used for ATP formation. PSII comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the psbA gene family function in marine Synechococcus?

The psbA gene family in marine Synechococcus encodes different isoforms of the D1 protein, which are expressed under varying environmental conditions. In most cyanobacterial species, the psbA multigene family shows a complex regulatory pattern that helps the organism adapt to different stress conditions. In marine Synechococcus specifically, genomic analysis has revealed that these organisms can contain up to six psbA gene copies per genome .

The gene family typically encodes two major D1 protein isoforms:

  • D1:1 - Encoded by a single gene in each genome, typically expressed constitutively under normal conditions

  • D1:2 - Can be encoded by multiple genes (up to five copies), primarily expressed under stress conditions

A key research finding is that even though Synechococcus sp. WH7803 contains three psbA genes encoding identical D1:2 isoforms, only one of these genes shows strong responsiveness to stress conditions like high light or UV radiation . This differential expression pattern suggests a complex regulatory mechanism that controls which gene copy is expressed under specific environmental conditions, despite encoding identical protein products.

What are the proper storage and handling conditions for Recombinant psbA3 protein?

For optimal stability and activity of Recombinant Synechococcus sp. Photosystem Q(B) Protein 3 (psbA3), researchers should follow these methodological guidelines:

Storage conditions:

  • Store the lyophilized powder at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • For working aliquots, store at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge the vial before opening to ensure contents settle at the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended default is 50%)

  • Aliquot for long-term storage at -20°C/-80°C

This methodological approach prevents protein degradation and maintains functional integrity. Repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and loss of activity, which would compromise experimental results. The addition of glycerol serves as a cryoprotectant that prevents the formation of ice crystals during freezing, which could otherwise damage the protein structure .

What is the role of the psbA3 gene product in Photosystem II function?

The psbA3 gene encodes the D1 protein (also known as Photosystem Q(B) protein 3), which is a core component of the Photosystem II (PSII) reaction center complex. This protein plays several critical roles in photosynthetic function:

  • Electron transport: The D1 protein binds the secondary electron acceptor QB (plastoquinone) and facilitates electron transfer from QA to QB during the light-dependent reactions of photosynthesis .

  • Proton-coupled electron transfer: The protein participates in proton-coupled electron transfer processes that contribute to the establishment of the proton gradient necessary for ATP synthesis .

  • Stress response: The D1:2 isoform (encoded by psbA3 in Synechococcus) is typically expressed under stress conditions such as high light (HL) or ultraviolet (UV) radiation exposure, replacing the constitutive D1:1 isoform .

  • Photoinhibition protection: The D1:2 isoform appears to provide enhanced resistance to photoinhibition under high light conditions. Research has shown that high light-acclimated cells expressing more D1:2 are more resistant to UV light damage than cells acclimated to low or medium light conditions .

The specific energetics of the QB site in PSII have been found to be comparable to those in the homologous purple bacterial reaction center, suggesting evolutionary conservation of this crucial photosynthetic mechanism .

How does light intensity affect psbA gene expression patterns in Synechococcus?

The expression patterns of psbA genes in marine Synechococcus exhibit a sophisticated response to varying light intensities, revealing a complex acclimation mechanism. Experimental data indicate a differential regulation pattern that depends on both prior light acclimation and subsequent light stress exposure:

Acclimation effects:

  • Cells acclimated to high light (HL) conditions develop significantly higher resistance to UV radiation compared to those acclimated to low light (LL) or medium light (ML) conditions .

  • This acclimation involves changes in the composition of the D1 protein pool, with different proportions of D1:1 and D1:2 isoforms.

Stress response patterns:

  • Both UV and high light exposure induce upregulation of psbA genes encoding the D1:2 isoform

  • Concurrently, these stress conditions repress the expression of psbA genes encoding the D1:1 isoform

Notably, despite Synechococcus sp. WH7803 containing three psbA genes that encode identical D1:2 protein isoforms, only one of these genes demonstrates strong responsiveness to stress conditions in experimental settings . This suggests the presence of complex regulatory elements that control the differential expression of these genes, possibly involving promoter differences, transcription factors, or other regulatory mechanisms that respond to specific light intensity thresholds.

This differential expression likely represents an evolutionary adaptation that allows these marine cyanobacteria to optimize photosynthetic efficiency while minimizing photodamage across the variable light regimes encountered in marine environments.

What methodological approaches can be used to express and purify recombinant psbA3 protein?

For researchers seeking to express and purify recombinant Synechococcus sp. psbA3 protein, a systematic methodological approach is required to ensure high yield and purity. Based on established protocols, the following comprehensive workflow is recommended:

Expression System Selection:

  • E. coli is the preferred heterologous expression system for psbA3 protein

  • For native expression, transformation of Synechococcus elongatus can be employed using specialized vectors such as pSyn_6

Transformation Protocol for Native Expression in Synechococcus:

  • Grow Synechococcus elongatus cultures to an OD750 between 1.0 and 2.0

  • Harvest 1.5 mL of cells by centrifugation at 14,000 rpm for 3 minutes

  • Wash cells once with BG-11 medium and resuspend in 100 μL of fresh BG-11

  • Add 100 ng of supercoiled plasmid DNA containing the psbA3 gene

  • Incubate the cell-DNA mixture at 34°C for 4 hours

  • Plate on BG-11 agar containing 10 μg/mL spectinomycin

  • Incubate under continuous illumination at 25-30°C for 5-7 days

Heterologous Expression in E. coli:

  • Clone the psbA3 gene into an expression vector with an N-terminal His-tag

  • Transform into an appropriate E. coli strain (e.g., BL21(DE3))

  • Induce protein expression with IPTG

  • Harvest cells and lyse to extract the recombinant protein

Purification Strategy:

  • Perform initial purification using Ni-NTA affinity chromatography, exploiting the His-tag

  • Further purify using size exclusion chromatography if higher purity is required

  • Assess protein purity using SDS-PAGE (should exceed 90%)

  • Lyophilize the purified protein in Tris/PBS-based buffer containing 6% trehalose at pH 8.0

This comprehensive approach ensures the production of high-quality recombinant protein suitable for downstream applications including structural studies, functional assays, and interaction analyses.

What evolutionary insights can be gained from studying the psbA gene family in marine Synechococcus?

Phylogenetic analysis of the psbA gene family in marine Synechococcus reveals fascinating evolutionary patterns that provide insights into both functional adaptation and gene family evolution. Examination of 11 marine Synechococcus genomic sequences has revealed several key evolutionary characteristics:

Genomic Distribution and Organization:

  • Marine Synechococcus genomes contain up to six psbA gene copies per genome

  • Invariably, a single gene encoding the D1:1 isoform is present in each genome

  • Multiple genes encoding the D1:2 isoform are typically present, ranging from 1-5 copies

Phylogenetic Clustering Patterns:

  • Marine Synechococcus genes encoding D1:1 cluster together phylogenetically across different species

  • In contrast, genes encoding D1:2 group by genome into subclusters

  • This suggests different evolutionary histories for D1:1 and D1:2 encoding genes

This phylogenetic pattern indicates that the D1:1 genes likely evolved under purifying selection, maintaining a conserved function across species. Conversely, the clustering of D1:2 genes by genome suggests either more recent gene duplication events within each genome or concerted evolution through gene conversion, maintaining sequence similarity within genomes.

The genomic context analysis of psbA genes further supports these evolutionary hypotheses, suggesting that while the D1:1 isoform maintains a conserved ancestral function, the multiple D1:2 copies may have evolved specialized regulatory mechanisms adapted to specific environmental stresses encountered by different Synechococcus strains in their respective ecological niches .

These evolutionary patterns reflect the importance of maintaining photosynthetic flexibility in variable marine environments, where light conditions can change rapidly and unpredictably.

How does the electron transfer mechanism function in the QB site of Photosystem II?

The electron transfer mechanism at the QB site of Photosystem II (PSII) in Synechococcus sp. represents a sophisticated proton-coupled electron transfer process that is fundamental to photosynthetic energy conversion. The D1 protein encoded by the psbA3 gene plays a central role in this mechanism:

Electron Transfer Pathway:

  • Initial photon absorption by chlorophyll molecules in the reaction center

  • Primary charge separation at P680 (special pair chlorophyll)

  • Electron transfer to pheophytin and then to the primary quinone acceptor QA

  • Subsequent electron transfer from QA to QB (bound to the D1 protein)

  • After receiving two electrons and two protons, the fully reduced QB (plastohydroquinone, PQH2) is released into the membrane

  • A new plastoquinone (PQ) from the membrane pool then binds to the QB site

Energetic Properties:
The midpoint potential (Em) of the QB/QB- couple is a critical parameter determining the energetics of this electron transfer. Research indicates that the energetics of QB in PSII are comparable to those in the homologous purple bacterial reaction center, suggesting evolutionary conservation of this fundamental mechanism .

Structural Determinants:
The amino acid sequence of the D1 protein, particularly in the regions that form the QB binding pocket, is crucial for proper function. The complete 344-amino acid sequence of the psbA3 gene product contains the transmembrane helices and connecting regions that form this pocket . Specific residues within this sequence directly interact with the QB molecule, positioning it optimally for electron transfer from QA and subsequent protonation.

This electron transfer mechanism is subject to regulation under stress conditions, with the D1:2 isoform potentially providing different electron transfer kinetics or stability properties that may contribute to stress resistance, particularly under high light or UV conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.