Recombinant Synechococcus sp. Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
crcB1; Syncc9605_0089; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Species
Synechococcus sp. (strain CC9605)
Target Names
crcB1
Target Protein Sequence
MAGSAPEAVLVGLGAIPGAWLRLKVVNHFQPMVPKKHWGTFLVNVVACFALGLVLALNET CTASTGIALLMGVGFFGSLSTFSTFAVELLNELRAGQLLTALVLAVASIGVGLLACAVGY GIGTHA
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of CrcB1 protein in Synechococcus sp.?

CrcB1 belongs to a family of membrane proteins that play crucial roles in fluoride ion (F⁻) transport and cellular protection mechanisms. In Synechococcus sp., CrcB1 is involved in fluoride ion efflux, which helps the cyanobacterium maintain ionic homeostasis, particularly under environmental conditions with elevated fluoride levels. This protein contributes to the organism's ability to survive in diverse marine environments by preventing toxic accumulation of fluoride ions within the cell .

What expression systems are most suitable for producing recombinant Synechococcus sp. CrcB1 protein?

For research applications requiring recombinant CrcB1 protein, several expression systems have demonstrated effectiveness:

Expression SystemAdvantagesLimitationsYield (mg/L culture)
E. coli BL21(DE3)High yield, rapid growthMay form inclusion bodies5-15
Synechococcus sp. PCC 11901Native folding, post-translational modificationsLower yield, longer cultivation2-8
Cell-free systemsAvoids toxicity issuesHigher cost, lower scale1-3

For homologous expression in Synechococcus sp. PCC 11901, genomic integration at neutral sites such as the mrr or aquI loci has proven effective for stable expression without compromising growth, even at high cell densities (OD750 > 100) . The Pcpc560 promoter drives high expression levels and can be effectively used for CrcB1 production in Synechococcus .

How can I optimize purification protocols for His-tagged CrcB1 protein?

For efficient purification of His-tagged CrcB1:

  • Cell lysis: Use either sonication (10 cycles, 30s on/30s off) or French press (15,000 psi) in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors.

  • Membrane protein solubilization: Incubate membrane fraction with 1% n-dodecyl-β-D-maltoside (DDM) or 1% digitonin for 2 hours at 4°C with gentle agitation.

  • Affinity chromatography: Load solubilized fraction on Ni-NTA resin equilibrated with buffer containing 0.05% DDM and 20 mM imidazole. Wash with 50 mM imidazole and elute with 250 mM imidazole.

  • Size exclusion chromatography: Apply to Superdex 200 column for final purification and buffer exchange to remove imidazole.

This approach typically yields 0.5-2 mg of purified protein per liter of Synechococcus culture when using the strong Pcpc560 promoter in PCC 11901 .

What genetic engineering strategies can be employed to optimize CrcB1 expression in Synechococcus sp. PCC 11901?

Advanced genetic engineering of Synechococcus sp. PCC 11901 for optimized CrcB1 expression requires careful selection of genetic elements and integration strategies:

  • Promoter selection: The Pcpc560, PJ23119, and PpsbA2L promoters have demonstrated the highest expression levels in PCC 11901, with Pcpc560 showing the strongest activity. For inducible expression, the 2,4-diacetylphloroglucinol (DAPG)-inducible PhlF repressor system provides tight regulation with a 228-fold dynamic range of induction .

  • Integration site: The mrr and aquI loci are the most suitable neutral sites for genomic integration, allowing growth to high cell densities (OD750 > 100) without affecting phenotype. The desB and NS1 sites are suitable only for lower density applications (OD750 < 50) .

  • Vector design considerations:

    • Spectinomycin resistance (SpR) is the preferred selection marker for PCC 11901

    • Genomic integration results in approximately 32% higher expression compared to RSF1010-based vectors in PCC 11901

    • Codon optimization should reflect the high GC content of Synechococcus sp.

  • Delivery method: Conjugation using E. coli helper strains proves effective for introducing heterologous DNA into PCC 11901, with spectinomycin selection providing robust selection of transconjugants without chlorotic phenotypes .

How can randomized complete block design (RCBD) improve experimental rigor when studying CrcB1 function?

When designing experiments to study CrcB1 function in Synechococcus sp., RCBD can significantly reduce experimental error and increase statistical power:

  • Application in CrcB1 functional studies:

    RCBD is particularly valuable when testing multiple variables affecting CrcB1 function, such as different growth conditions, mutant variants, or environmental stressors. By grouping experimental units into blocks (replicates) where conditions are as uniform as possible, RCBD helps isolate treatment effects from environmental variation .

  • Experimental design:

    Block (Rep)Treatment A (WT CrcB1)Treatment B (ΔCrcB1)Treatment C (CrcB1 overexpression)
    Rep 1Randomized positionRandomized positionRandomized position
    Rep 2Randomized positionRandomized positionRandomized position
    Rep 3Randomized positionRandomized positionRandomized position
  • Advantages for CrcB1 research:

    • Generally more precise than completely randomized designs

    • Flexible regarding treatment numbers and replication

    • Valid comparisons even if experimental error is heterogeneous

  • Statistical analysis considerations:

    • The appropriate error term for testing treatment effects is the experimental error (Rep × Treatment interaction), not the sampling error

    • When calculating least significant differences (LSD), use the experimental error mean square

What strategies can resolve common challenges in CrcB1 structural characterization?

Membrane proteins like CrcB1 present significant challenges for structural characterization. Advanced approaches include:

  • Cryo-electron microscopy (cryo-EM):

    • Sample preparation: Use nanodiscs or amphipols to maintain native-like lipid environment

    • Data collection: Collect 2,000-5,000 micrographs at 300kV with 0.5-1.0 e-/Ų/s exposure

    • Processing: Apply 2D classification followed by 3D reconstruction with C2 symmetry

  • X-ray crystallography optimization:

    • Crystal screening: Test detergents including DDM, LMNG, and GDN in combination with lipid additives (DMPC, DOPC)

    • Crystallization techniques: Lipidic cubic phase (LCP) and bicelle methods often succeed where vapor diffusion fails

    • Construct optimization: Design fusion proteins with stabilizing domains (e.g., T4 lysozyme or BRIL) inserted between transmembrane helices

  • Computational approaches:

    • Homology modeling: Build models based on structurally characterized CrcB homologs

    • Molecular dynamics: Simulate protein behavior in membrane environment to refine models

    • AlphaFold2 integration: Combine AI-predicted structures with experimental validation

How can CRISPR-based systems be employed to study CrcB1 function in Synechococcus sp. PCC 11901?

A DAPG-inducible dCas9-based CRISPR interference (CRISPRi) system has been developed for Synechococcus sp. PCC 11901 and can be effectively applied to study CrcB1 :

  • System components:

    • dCas9 expression cassette under DAPG-inducible promoter

    • sgRNA design targeting CrcB1 promoter or coding regions

    • DAPG inducer at concentrations between 1-10 μM

  • Experimental design for CrcB1 knockdown studies:

    • Design 3-5 sgRNAs targeting different regions of CrcB1

    • Create RCBD with factors: sgRNA target site, DAPG concentration, exposure time

    • Measure CrcB1 transcript levels by RT-qPCR and protein levels by Western blot

    • Assess phenotypic changes in fluoride sensitivity

  • Validation controls:

    • Non-targeting sgRNA

    • Wild-type cells without dCas9

    • Complementation with CrcB1 variant resistant to sgRNA targeting

  • Analyzing knockdown effects:

    • Growth curves in media with varying fluoride concentrations

    • Membrane permeability assays

    • RNA-seq to identify compensatory pathways

This approach allows precise temporal control over CrcB1 expression, enabling detailed functional characterization without the complications of lethal phenotypes that might arise from complete gene deletion.

What is the optimal experimental approach to determine CrcB1 substrate specificity?

To rigorously determine CrcB1 substrate specificity:

  • Reconstitution assays:

    • Purify His-tagged CrcB1 using the protocol in section 1.3

    • Reconstitute into proteoliposomes with varying lipid compositions

    • Load liposomes with potential substrate ions (F⁻, Cl⁻, Br⁻, I⁻)

    • Measure ion efflux using ion-selective electrodes or fluorescent indicators

  • Whole-cell assays:

    • Generate CrcB1 knockout, wild-type, and overexpression strains in Synechococcus sp. PCC 11901

    • Expose cells to media containing different potential substrate ions

    • Measure intracellular ion accumulation using ICP-MS

    • Assess growth inhibition in response to ion exposure

  • Electrophysiology:

    • Express CrcB1 in Xenopus oocytes or incorporate purified protein into planar lipid bilayers

    • Perform patch-clamp recordings to measure ion conductance

    • Determine ion selectivity by measuring reversal potentials with different ion gradients

  • Binding assays:

    • Perform isothermal titration calorimetry (ITC) with purified CrcB1 and potential substrates

    • Use microscale thermophoresis (MST) to measure binding affinities

    • Employ fluorescence-based assays with environment-sensitive probes

Data from these complementary approaches should be integrated to develop a comprehensive model of CrcB1 substrate specificity.

How can transcriptomics and proteomics be integrated to understand CrcB1 regulation in Synechococcus sp.?

An integrated multi-omics approach to understand CrcB1 regulation:

  • Experimental design:

    • Create a RCBD with factors: growth phase, light intensity, fluoride concentration

    • Include CrcB1 knockout and overexpression strains alongside wild-type

    • Collect samples for parallel RNA-seq and proteomics at each condition

    • Include technical and biological replicates to ensure statistical power

  • RNA-seq methodology:

    • Extract total RNA using TRIzol with modifications for cyanobacterial cells

    • Enrich mRNA by rRNA depletion rather than poly(A) selection

    • Prepare strand-specific libraries and sequence to >20 million reads per sample

    • Analyze using DESeq2 with special attention to normalization methods for cyanobacteria

  • Proteomics workflow:

    • Extract proteins using buffer containing 4% SDS, 100 mM Tris-HCl pH 7.5, 100 mM DTT

    • Perform either TMT labeling for multiplexed samples or label-free quantification

    • Analyze membrane fraction separately with specialized extraction protocols

    • Use data-independent acquisition (DIA) for improved quantification

  • Integration strategies:

    • Calculate protein-to-mRNA ratios to identify post-transcriptional regulation

    • Apply gene set enrichment analysis (GSEA) to identify coordinated regulatory modules

    • Construct regulatory networks using weighted gene correlation network analysis (WGCNA)

    • Validate key interactions using chromatin immunoprecipitation (ChIP-seq)

This comprehensive approach allows dissection of transcriptional, post-transcriptional, and post-translational regulatory mechanisms affecting CrcB1 expression and function.

How can I resolve common issues with recombinant CrcB1 expression in Synechococcus sp. PCC 11901?

ProblemPossible CausesSolutions
Low expression levelsWeak promoter, codon bias, toxic effectsSwitch to stronger promoter (Pcpc560), optimize codons, use inducible system (DAPG-PhlF)
Protein aggregationImproper folding, overexpressionLower induction level, express at lower temperature, co-express chaperones
Segregation failureEssential gene disruption, inefficient recombinationConfirm neutral site selection (mrr or aquI recommended) , increase homology arm length
Plasmid instabilityKanamycin resistance issuesUse spectinomycin resistance instead of kanamycin (PCC 11901 has native kanamycin resistance)
Chlorotic phenotypeMetabolic burdenAvoid desB and NS1 integration sites at high cell densities (OD750 > 50)
Poor growth post-transformationAntibiotic concentration too highUse 25 μg/mL spectinomycin for selection in PCC 11901

When experiencing expression issues, remember that genomic integration at the mrr locus yields approximately 32% higher expression levels compared to RSF1010-based vectors in PCC 11901 .

What statistical approaches are appropriate for analyzing CrcB1 functional data from RCBD experiments?

When analyzing data from RCBD experiments investigating CrcB1 function:

  • ANOVA structure:

    • Sources of variation: Replication, Treatment, Experimental Error, Sampling Error

    • F-tests: Test treatment effects using Experimental Error as denominator

    • Degrees of freedom: For Experimental Error = (r-1)(t-1), where r = replications, t = treatments

  • Multiple comparisons:

    • Calculate LSD using the Experimental Error mean square, not the Sampling Error

    • Consider Tukey's HSD for controlling familywise error rate when comparing all pairs

    • Use Dunnett's test when comparing treatments to a control condition

  • Handling missing data:

    • Missing values can be estimated using the formula:
      Y̅ = [tY.j + rYi. - Y..]/[(r-1)(t-1)]
      Where Y.j = replicate total, Yi. = treatment total, Y.. = grand total

    • With multiple missing values, iterative estimation is required

  • Mixed-effects modeling:

    • Treat replication as a random effect and treatments as fixed effects

    • Implement using R packages like 'lme4' or 'nlme'

    • Account for heteroscedasticity if present

  • Power analysis:

    • For future experiments, calculate required sample size using:
      n = 2(Zα/2 + Zβ)²σ²/δ²
      Where σ² is estimated from the Experimental Error and δ is the minimum detectable difference

These approaches ensure robust statistical inference when analyzing complex datasets from CrcB1 functional studies.

What are the future research directions for Synechococcus sp. CrcB1 protein studies?

Emerging research opportunities for CrcB1 in Synechococcus sp. include:

  • Structure-function relationships:

    • Determining high-resolution structures of CrcB1 in different conformational states

    • Mapping the ion translocation pathway through mutagenesis and molecular dynamics

    • Investigating oligomerization and protein-protein interactions

  • Physiological roles:

    • Exploring CrcB1 involvement in stress responses beyond fluoride resistance

    • Investigating its contribution to environmental adaptation in marine ecosystems

    • Examining potential roles in pH homeostasis and general ion transport

  • Biotechnological applications:

    • Engineering CrcB1 variants with enhanced fluoride efflux for bioremediation

    • Exploiting the fast-growing Synechococcus sp. PCC 11901 as a platform organism

    • Developing biosensors based on CrcB1 function

  • System-level integration:

    • Unraveling the CrcB1 interactome and its position in cellular signaling networks

    • Comparative genomics across cyanobacterial species to understand evolutionary conservation

    • Multi-omics approaches to place CrcB1 in the broader context of cellular physiology

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.