Recombinant Synechococcus sp. Proton extrusion protein PcxA (pcxA)

Shipped with Ice Packs
In Stock

Description

Definition and Significance

Recombinant PcxA is a modified version of the native proton extrusion protein expressed in Synechococcus sp. strains, optimized for purification and functional studies. It plays a key role in maintaining proton gradients across cellular membranes, a process essential for nutrient uptake, pH regulation, and energy transduction in cyanobacteria .

Biochemical Functions

PcxA exhibits multifunctional roles, as demonstrated by biochemical assays and homology studies:

FunctionRelated Proteins
ATP bindingMINK1, SMC6, AURKA, PKN1
Metal ion bindingZRSR2, COL10A1, OLA1, ASAP1
Biotin carboxylase activityMCCC1, PC, ACACA, PCCA, PCXB
DNA bindingCROP, FOXL1, TRERF1, HOXA2B

These functions suggest involvement in energy-dependent transport and enzymatic regulation .

Pathways and Physiological Roles

While direct pathway data for PcxA is limited, its homology to ABC transporters and proton pumps provides insights:

  • Proton extrusion: Likely contributes to maintaining intracellular pH under stress, analogous to Synechocystis sp. PxcA (CotA), which extrudes H⁺ to counteract acidification .

  • Ion homeostasis: Cooperates with sodium/sulfate symporters and ABC transporters in nutrient uptake, as observed in Synechococcus sp. PCC 7002 .

  • Energy metabolism: ATP hydrolysis by PcxA may drive secondary active transport of substrates like bicarbonate or metals .

Research Applications

Recombinant PcxA is a valuable tool for:

  • Mechanistic studies: Investigating ATP-dependent proton transport kinetics using purified protein .

  • Synthetic biology: Engineering cyanobacterial strains for enhanced biofuel production or environmental stress tolerance .

  • Biotechnological modeling: Informing the design of artificial ion transporters for industrial applications .

Comparative Insights

  • Homologs: PcxA shares functional similarities with Synechocystis sp. PxcA (CotA), which is essential for CO₂ transport and acid resistance .

  • Divergence: Unlike freshwater cyanobacterial homologs, marine Synechococcus sp. PcxA may exhibit adaptations to high-salinity environments, though direct evidence is pending .

Outstanding Questions

  • Does PcxA form a complex with other transporters, such as bicarbonate uptake systems?

  • How does its activity vary under light/dark cycles or nitrogen limitation?

  • Can structural elucidation via cryo-EM resolve its conformational dynamics?

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
pcxA; CYA_2560; Proton extrusion protein PcxA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-460
Protein Length
full length protein
Species
Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)
Target Names
pcxA
Target Protein Sequence
MGESVLSRLGQWISSTPLRSLDRAYEAALRIKAIEDRYFQGGSIGSNGNHGQNTSRYFQI QLRQELRQIDLSLAEFRASSVFSRLPDPEQNGSGPPFSSDKDQAKEAPVGPSENDGKDAE NGRQSRDPSILEKLEFIDQVTSRYKRPAAQPRSTSPPPKSQEQPEPLTSSQPEPSDPSIK TNLAKTNLDNSNAPVASKTALLPRSILRTANQIRRELSSQAEEELLQEYRSQRTRTLVAV RFLLLLAILPLLVQIFSKHFLFGPLVDRFQPREPTILALSYEFQEKALSEFEFFKEKIEF ERALHHQSPELDLESEDQLSKKAEELLQKYSRKNLEGLKNVLADVLSLLVFGWLILIGRE EIEVLKSFLDRLIYGLSDSAKAFIIILFTDVFVGYHSPHGWEVLLSSLAAHLGLPENRNF IYGFIATFPVFLDTLFKYWIFRYLNRVSPSAVATYHAMND
Uniprot No.

Target Background

Function
This protein is involved in light-induced, Na⁺-dependent proton extrusion and may also participate in CO₂ transport.
Database Links
Protein Families
Cema family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal growth conditions for Synechococcus sp. strains expressing recombinant pcxA?

Synechococcus sp. PCC 7002 can be successfully cultured at 37°C when adapting to human cell media conditions. For optimal oxygen production (which may be relevant to proton extrusion function), a bacterial concentration of at least 1 × 10^7 cells/mL is recommended to ensure sufficient metabolic activity. Experiments have demonstrated that under hypoxic conditions (1% O₂), bacterial concentrations of 1 × 10^8 cells/mL can achieve oxygen content above 50% after 10 hours, while concentrations below 1 × 10^6 cells/mL yield considerably lower oxygen levels (5.97 ± 1.25% at 1 × 10^6 and 3.62 ± 0.21% at 1 × 10^4) .

How does the presence of pcxA expression affect Synechococcus sp. compatibility with other biological systems?

Studies examining Synechococcus sp. PCC 7002 have demonstrated its biocompatibility with human dermal cells, including both fibroblasts and keratinocytes. While initial cytotoxicity may be observed in coculture with 3T3 fibroblasts after 2 days, these effects typically resolve by day 4. This suggests that recombinant strains expressing modified proteins can potentially maintain biocompatibility, although specific modifications to proton extrusion mechanisms should be carefully evaluated .

What methods are most effective for gene insertion when working with pcxA in Synechococcus sp.?

Conventional transformation in Synechococcus sp. PCC 7002 employs antibiotic resistance markers, which presents limitations for multigenic strain engineering. For pcxA manipulation, markerless genetic techniques are preferred. Recent advancements utilize a mutated phenylalanyl-tRNA synthetase gene (pheS) introduced temporarily into the genome for counter selection. This approach allows for the subsequent elimination of selection markers, facilitating multiple genetic modifications without accumulating resistance genes .

How can I design a robust markerless transformation system for pcxA modification in Synechococcus sp.?

A recommended approach involves using a mutated pheS gene with specific amino acid substitutions (T261A and A303G) that confer susceptibility to p-chlorophenylalanine (PCPA). The workflow includes:

  • Construct a plasmid containing:

    • Homologous regions flanking the target insertion site

    • The desired pcxA modification

    • An antibiotic resistance marker

    • The mutated pheS gene

  • Transform Synechococcus sp. via double crossover recombination and select transformants using antibiotic selection.

  • Subject transformants to PCPA selection (optimal concentration: 20 μg/mL), which eliminates cells retaining the mutated pheS gene.

  • Verify successful markerless modification through PCR confirmation of complete marker gene elimination .

What factors should be considered when designing experiments to evaluate pcxA function across different environmental conditions?

When designing experiments to assess pcxA function across various conditions, researchers should implement a controlled factorial design. Based on established experimental frameworks, consider including:

FactorRecommended Test Levels
Light intensityLow (e.g., 50 μmol photons m^-2 s^-1), Standard (100-150), High (200+)
Temperature30°C, 37°C, 40°C
Media compositionStandard A+, Modified with human cell media components
pH gradientsAcidic (6.0), Neutral (7.5), Alkaline (9.0)

Measurements should be taken at multiple time points (e.g., T₀, T₁, T₂, T₃, T₄) over the experimental duration, with appropriate controls for each condition. Parameters to monitor may include growth rate, protein expression levels, proton gradient measurements, and photosynthetic efficiency .

How can I optimize codon usage for improved pcxA expression in recombinant systems?

While optimizing pcxA expression, consider the following methodology:

  • Analyze the native codon usage pattern of the pcxA gene compared to codon preferences in your expression host.

  • When designing synthetic mutated pheS genes for selection, use synonymous codons to reduce homology with native sequences, thereby minimizing undesired recombination events between mutated and native pheS genes. This approach has been successfully used in various bacteria including Streptococcus mutans .

  • Implement a strong endogenous promoter to ensure robust expression of your recombinant pcxA, as successful phenotypic expression depends significantly on expression levels. The high homology between E. coli and PCC 7002 gene systems (69% similarity reported for pheS) suggests that well-characterized E. coli promoters may function effectively in Synechococcus sp. .

What strategies can overcome segregation challenges when introducing modified pcxA genes?

Complete segregation of modified pcxA genes can be challenging in polyploid cyanobacteria. To address this:

  • Employ extended antibiotic selection periods after initial transformation to ensure complete replacement of all genomic copies.

  • Use PCR verification with primers that specifically target both the modified region and the wild-type sequence to confirm complete segregation.

  • When false positives occur during counter-selection (observed at rates <25% in similar systems), implement additional PCR verification targeting deleted regions of the targeted genomic locus to confirm homozygosity.

  • Consider that incomplete segregation may result in wild-type revertants or heterozygous strains containing both wild-type and modified genomic regions. Additional selection cycles may be necessary to achieve complete segregation .

What considerations are important when evaluating Synechococcus sp. with modified pcxA for biomedical applications?

When assessing Synechococcus sp. strains with modified pcxA for biomedical applications, researchers should:

  • Conduct thorough biocompatibility testing with relevant human cell types. Research has demonstrated that Synechococcus sp. PCC 7002 can coexist with human dermal cells, including fibroblasts and keratinocytes, without significant adverse effects on cell viability and growth after initial adaptation periods.

  • Evaluate potential cytotoxicity through multiple assays (such as LDH assays) and varying time points, as initial negative effects observed at day 2 may resolve by day 4 of coculture.

  • Assess oxygen production capabilities under different conditions, as oxygen generation may be a beneficial property for certain biomedical applications. Bacterial concentrations of at least 1 × 10^7 cells/mL are recommended to ensure sufficient oxygenation.

  • Consider utilizing inserts and specialized coculture systems when adapting cyanobacterial culture conditions to 37°C with supplementation of human cell media under constant illumination .

How can I assess the potential of pcxA-modified Synechococcus sp. for integration into tissue engineering approaches?

To evaluate pcxA-modified Synechococcus sp. for tissue engineering applications:

  • Develop coculture systems with relevant human cell types, particularly dermal cells such as fibroblasts and keratinocytes if targeting skin applications.

  • Implement bioactivated scaffold systems, similar to those developed for other cyanobacteria-based regenerative approaches. Previous research groups have successfully developed cyanobacteria-bioactivated scaffolds and examined their regenerative potential in vitro.

  • Conduct comprehensive cytotoxicity assessments of both the bacteria and their cultivation media on target human cells.

  • Design controlled experiments that evaluate the influence of pcxA modifications on:

    • Cellular attachment and proliferation on scaffolds

    • Oxygen generation capability in hypoxic environments

    • Long-term stability of the engineered system

    • Potential immune responses to the bacterial components

  • Progress from in vitro testing to appropriate animal models before considering human applications .

What are common challenges when attempting markerless pcxA modifications, and how can they be addressed?

Common challenges in markerless pcxA modifications include:

  • Insufficient PCPA susceptibility: Ensure the pheS mutations effectively confer PCPA sensitivity. The combination of T261A and A303G substitutions has been demonstrated to be most effective in Synechococcus sp. PCC 7002, with A303G being particularly crucial for PCPA susceptibility.

  • Unintended recombination between mutated and native pheS genes: While this theoretical concern was not a major issue in practice (<25% false positive rate), researchers should verify complete segregation through PCR confirmation.

  • False positives during counter-selection: These may arise through:

    • Insufficient toxicity of the mutated pheS gene

    • Unintended mutations in other genomic regions

    • Incomplete segregation resulting in wild-type revertants or heterozygous strains

  • Low transformation efficiency: To improve results, optimize DNA concentrations, ensure high quality of prepared DNA, and extend incubation periods during the transformation process .

How do I select appropriate control conditions when evaluating pcxA function in experimental settings?

When designing control conditions for pcxA function assessment:

  • Include both positive and negative controls:

    • Wild-type Synechococcus sp. without modification

    • Strains with knockout of pcxA but no replacement

    • Strains with marker insertion but no functional gene changes

  • Implement a test matrix that varies relevant environmental parameters systematically. For material coating experiments (which may be analogous to some pcxA experimental designs), consider factors such as:

FactorControl Levels
Exposure typeNo exposure (natural aging only)
ProtectionNo protection (baseline)
Time seriesT₀, T₁, T₂, T₃, T₄ measurements
  • Measure multiple parameters to comprehensively assess function, including growth rates, protein expression levels, and specific activity measurements.

  • Document all "non-controlled" variables as continuous variables to account for potential confounding factors in your analysis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.