Recombinant Synechococcus sp. UPF0754 membrane protein CYB_2931 (CYB_2931)

What is Synechococcus sp. UPF0754 membrane protein CYB_2931?

CYB_2931 is a membrane protein belonging to the UPF0754 protein family found in Synechococcus sp. (strain JA-2-3B'a(2-13)), also known as Cyanobacteria bacterium Yellowstone B-Prime. The protein consists of 406 amino acids with a molecular weight of approximately 45 kDa and is characterized by its transmembrane domains and distinctive amino acid sequence. While classified as a protein of unknown function (UPF), structural analysis suggests it may play roles in membrane integrity or transport processes within this photosynthetic organism .

The protein is identified in the UniProt database with accession number Q2JHS8, and its gene is designated as CYB_2931 in the organism's genome. As a membrane protein, it contains hydrophobic regions that integrate into the cell membrane, with the sequence suggesting multiple transmembrane spanning domains characteristic of transport or channel proteins .

What expression systems are recommended for recombinant CYB_2931 production?

For optimal expression of recombinant CYB_2931, consider the following methodological approaches:

• E. coli-based expression systems: While E. coli is commonly used for recombinant protein production, membrane proteins often require specialized strains like C41(DE3) or C43(DE3) that are engineered to handle membrane protein overexpression. The protein should be expressed with a fusion tag (His, GST, or MBP) to facilitate purification.

• Cyanobacterial expression systems: For more native-like expression, consider using related Synechococcus strains like PCC 7002, which has well-established genetic manipulation techniques. Recent markerless gene manipulation techniques have significantly improved the ability to work with these organisms .

• Cell-free expression systems: These can be advantageous for membrane proteins as they avoid toxicity issues and allow direct incorporation into artificial membrane environments.

A comparison of expression systems is presented in Table 1:

How should recombinant CYB_2931 be stored for maximum stability?

Recombinant CYB_2931 stability is critical for experimental success. Optimal storage conditions include:

• Store at -20°C for short-term or -80°C for extended storage.

• Use Tris-based buffer with 50% glycerol as described in product specifications .

• Avoid repeated freeze-thaw cycles, as these can significantly degrade membrane proteins.

• For working aliquots, store at 4°C for up to one week to maintain protein integrity .

For membrane proteins like CYB_2931, addition of appropriate detergents or lipids during storage may help maintain native conformation. Consider supplementing storage buffers with mild detergents like DDM (n-dodecyl-β-D-maltoside) at concentrations just above the critical micelle concentration to stabilize the hydrophobic domains.

What techniques are most effective for studying CYB_2931 structure-function relationships?

For comprehensive structural and functional characterization of CYB_2931, researchers should consider these methodological approaches:

• Cryo-electron microscopy (Cryo-EM): Particularly suitable for membrane proteins like CYB_2931, offering resolution to near-atomic level without crystallization. Sample preparation should include screening of various detergents to identify those that maintain native protein conformation.

• Site-directed mutagenesis: Systematic mutation of conserved residues based on the amino acid sequence (particularly those in transmembrane regions: MAFWIYVVPPLAGLVIGYFTNDIAIKMLFR) can help identify functional domains . Focus on residues unique to UPF0754 family proteins.

• Membrane topology mapping: Combining bioinformatic predictions with experimental approaches such as cysteine scanning mutagenesis and accessibility assays to determine transmembrane segments and their orientation.

• Functional reconstitution: Incorporation of purified CYB_2931 into liposomes or nanodiscs to study transport activity or interaction with other membrane components.

Implementation of these techniques should be guided by the full amino acid sequence of CYB_2931, with particular attention to highly conserved residues across the UPF0754 family .

What genetic manipulation strategies are most effective for studying CYB_2931 function in vivo?

Recent advances in cyanobacterial genetic engineering provide several approaches:

• Markerless gene modification: The phenylalanyl-tRNA synthetase (pheS) counter-selection system developed for Picosynechococcus sp. PCC 7002 allows for markerless modification without requiring host strain adaptations . This technique introduces specific mutations (T261A and A303G) in the pheS gene, allowing counter-selection with p-chlorophenylalanine.

• CRISPR-Cas9 techniques: Adapted for cyanobacteria, these provide precise genome editing capabilities for:

  • Gene knockout

  • Promoter replacements

  • Protein tagging

  • Point mutations

• Inducible expression systems: For temporal control of CYB_2931 expression, consider:

  • Nickel-inducible promoters (nrsB)

  • Copper-regulated systems (petE)

  • Light-responsive promoters

A methodological workflow for markerless manipulation of CYB_2931 would include:

• Construct design with homologous regions flanking CYB_2931

• Introduction of mutated pheS for counter-selection

• Two-step selection process using both positive and negative selection

• PCR verification of the resulting markerless modifications

How can researchers distinguish between direct and indirect effects when studying CYB_2931 mutations?

When investigating phenotypic effects of CYB_2931 manipulation, consider these methodological approaches:

• Complementation studies: Reintroduce wild-type or mutant versions of CYB_2931 in knockout strains to verify direct causation of observed phenotypes.

• Transcriptomic profiling: Compare global gene expression patterns between wild-type and CYB_2931 mutant strains to identify downstream effects and potential compensatory responses.

• Metabolomic analysis: Changes in metabolite profiles can reveal functional roles. For membrane proteins, focus on membrane lipids, signaling molecules, and transported substrates.

• Protein-protein interaction studies: Techniques such as co-immunoprecipitation, bacterial two-hybrid systems, or proximity labeling can identify direct interaction partners of CYB_2931.

• Control experiments: Include parallel studies with unrelated membrane protein mutations to distinguish general membrane disruption effects from specific CYB_2931 functions.

What are the key considerations for designing CYB_2931 purification protocols?

Purifying membrane proteins like CYB_2931 requires specialized approaches:

• Membrane isolation: Begin with gentle cell lysis followed by differential centrifugation to isolate membrane fractions. For cyanobacteria, consider protocols that separate thylakoid and plasma membranes.

• Detergent selection: Test multiple detergents for solubilization efficiency and protein stability:

  • Mild detergents (DDM, LMNG) for initial extraction

  • Screening detergent panels to optimize yield and activity

• Chromatography strategy: Implementation of a multi-step purification:

  • Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

  • Size exclusion chromatography to remove aggregates

  • Ion exchange chromatography for final polishing

• Protein quality assessment: Monitor protein homogeneity and stability through:

  • Dynamic light scattering

  • Circular dichroism to verify secondary structure

  • Thermal shift assays to evaluate stability in different buffers

How can CYB_2931 be incorporated into functional assays to determine its biochemical role?

To elucidate the function of this uncharacterized membrane protein:

• Reconstitution in artificial membrane systems:

  • Proteoliposomes for transport assays

  • Nanodiscs for structural and interaction studies

  • Planar lipid bilayers for electrophysiological measurements

• Transport assays: Design experiments to test substrate specificity:

  • Radioisotope flux measurements

  • Fluorescent substrate tracking

  • Ion-selective electrode monitoring

• Protein-lipid interactions: Examine how CYB_2931 interacts with membrane components:

  • Native mass spectrometry to identify bound lipids

  • Fluorescence resonance energy transfer (FRET) to measure proximity to other membrane components

  • Lipid binding assays using model membranes of varying composition

• Integration with photosynthetic machinery: Since Synechococcus demonstrates exceptional photosynthetic efficiency , investigate potential connections:

  • Co-localization studies with photosynthetic complexes

  • Measurement of electron transport rates in strains with modified CYB_2931 levels

  • Binding assays with isolated photosynthetic components

How should researchers interpret phenotypic changes in CYB_2931 mutant strains?

When analyzing phenotypic data from CYB_2931 mutants:

• Growth parameter analysis: Compare growth rates under varied conditions (light intensity, nutrient availability, stress factors) between wild-type and mutant strains. Synechococcus strains typically demonstrate distinctive irradiance-dependent responses that can be categorized into "light-limited" and "light-saturated" regimes .

• Photosynthetic measurements: Examine parameters including:

  • Oxygen evolution rates

  • Relative electron transport rates (rETR)

  • Quantum yield of photochemistry (αr)

  • Photosynthetic quotient (Q)

• Cell morphology assessment: Cell volume changes may indicate adaptation mechanisms, as seen in ultrafast-growing Synechococcus strains that exhibit up to 300% expansion in cell volume .

• Statistical approach: Apply two-way repeated measures ANOVA with appropriate post-hoc tests (Dunnett's or Sidak method) as used in cyanobacterial research to determine significance of phenotypic differences .

What bioinformatic approaches can help predict CYB_2931 function?

In silico methods provide valuable insights for uncharacterized proteins:

• Homology modeling: Using the amino acid sequence of CYB_2931 , create structural models based on homologous proteins with known structures.

• Conserved domain analysis: Identify functional motifs across the UPF0754 family to predict biochemical roles.

• Co-evolution analysis: Examine evolutionary patterns to identify potential interaction partners or functionally related proteins.

• Genomic context: Analyze genes adjacent to CYB_2931 in the Synechococcus genome for functional clues.

• Systems biology integration: Incorporate CYB_2931 into metabolic models of Synechococcus to predict systemic effects of mutations.

How might CYB_2931 be utilized in synthetic biology applications?

The potential applications of CYB_2931 in synthetic biology include:

• Photosynthetic efficiency enhancement: If CYB_2931 contributes to the remarkable photosynthetic capacity of Synechococcus, its manipulation could improve bioproduction in engineered cyanobacteria .

• Biosensor development: Membrane proteins can be repurposed as sensors for environmental monitoring or metabolite detection.

• Chassis optimization: Understanding the role of CYB_2931 in membrane function could lead to improved cyanobacterial chassis for chemical production, building on existing work with Picosynechococcus sp. PCC 7002 .

• Biomedical applications: Synechococcus-based systems have shown promise in biomedical contexts, such as rescuing ischemic heart muscle through photosynthetic oxygen production . Membrane proteins contributing to physiological resilience could be valuable in these applications.

What are the key methodological challenges in studying membrane proteins like CYB_2931 in cyanobacteria?

Researchers face several challenges when working with cyanobacterial membrane proteins:

• Complex membrane systems: Cyanobacteria contain both plasma membranes and thylakoid membranes, complicating isolation of specific membrane proteins.

• Protein yield limitations: Despite advanced genetic tools, obtaining sufficient quantities of membrane proteins for structural studies remains challenging.

• Functional assay development: For uncharacterized proteins like CYB_2931, designing appropriate functional assays requires systematic hypothesis testing.

• Physiological relevance: Ensuring that in vitro studies reflect the protein's actual role in the complex cyanobacterial physiology.

• Genetic tool limitations: While significant advances have been made in markerless genetic manipulation , further refinement of tools specific to membrane protein studies in cyanobacteria is needed.

Addressing these challenges requires interdisciplinary approaches combining molecular biology, biochemistry, biophysics, and systems biology to fully elucidate the role of membrane proteins like CYB_2931 in the remarkable physiological capabilities of Synechococcus species.