Recombinant Synechococcus sp. UPF0754 membrane protein syc0451_d (syc0451_d)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Synechococcus sp. UPF0754 Membrane Protein syc0451_d

The Recombinant Synechococcus sp. UPF0754 membrane protein syc0451_d is a recombinant protein derived from the cyanobacterium Synechococcus. This protein is part of the UPF0754 family and is expressed in Escherichia coli (E. coli) with a His-tag for purification purposes. The protein's full-length sequence spans 412 amino acids and is available as a lyophilized powder .

Amino Acid Sequence

The amino acid sequence of the syc0451_d protein is provided in the product specifications and includes a variety of hydrophobic and hydrophilic regions typical of membrane proteins .

Comparison with Other Membrane Proteins

ProteinFunctionLocationSpecies
syc0451_dUnknownMembraneSynechococcus sp.
SmpXPore-formingMembraneSynechococcus
Cytochrome OxidaseElectron transportCytoplasmic membraneSynechococcus sp. PCC7942

References Creative Biomart. Recombinant Full Length Synechococcus Sp. Upf0754 Membrane Protein Syc0451_D(Syc0451_D) Protein, His-Tagged. PubMed. A Synechococcus gene encoding a putative pore-forming intrinsic membrane protein. PMC. Localization of Membrane Proteins in the Cyanobacterium Synechococcus sp. PCC7942. PMC. Global Landscape of Native Protein Complexes in Synechocystis sp. PCC 6803. PMC. Native architecture and acclimation of photosynthetic membranes in a fast-growing cyanobacterium. PMC. Identification and bioinformatic analysis of the membrane proteins of Synechocystis sp. PCC 6803. PMC. Development of a Biotechnology Platform for the Fast-Growing Cyanobacterium Synechococcus sp. PCC 11901. PMC. Newly discovered Synechococcus sp. PCC 11901 is a robust cyanobacterial strain for high biomass production.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
syc0451_d; UPF0754 membrane protein syc0451_d
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-412
Protein Length
full length protein
Species
Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)
Target Names
syc0451_d
Target Protein Sequence
MDGRTLGLWLLPPVVGGIIGYFTNDLAIRMLFRPYRPVVIGGWQLPFTPGLIPANQGRLA RRIADAILGSLLTPDALHDLARRLLELPRLEAAIAWLVSLLLERLREVRDPRSIEVAADV LRDLAGSALPRWLRAIVRQRQGLDAQIDRWFEQQLLSQKLGPLQAQQLGDWLLEGAFPPD QIRRVMLDFLTDDNIRNLDRIVRDRTRGTDWVIANLFGVQSSLQRLRQFLREQPEAGDAV IAELSQRLALRQQLSQALQTFQLTDLPQTTLTDLRLQLRQGLRQWLDQDGLSLLEGALGG LDWTAAARALLDRLRTAVISDEAIAAFRHEVALILDQRLEHELEDLVAAALPILALEDLI IGRVEATPAADLEAAIQGIVRSELQAIVNIGGVLGVLLGCVQSLINVWSLST
Uniprot No.

Target Background

Database Links
Protein Families
UPF0754 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the predicted function of the UPF0754 membrane protein syc0451_d?

While the specific function of UPF0754 membrane protein syc0451_d has not been definitively characterized, analysis of similar membrane proteins in Synechococcus species suggests potential roles in membrane transport processes. For instance, Synechococcus sp. PCC7942 contains membrane proteins involved in copper transport, including a copper-transporting P-type ATPase located in the thylakoid membrane .

Based on sequence homology and the presence of characteristic membrane protein domains, the syc0451_d protein may function in:

  • Small molecule or ion transport across membranes

  • Membrane integrity maintenance

  • Signaling processes

  • Potential involvement in photosynthetic or respiratory pathways

Systematic functional studies including gene knockout experiments, complementation assays, and transport studies would be necessary to definitively establish this protein's function in Synechococcus sp. .

How does the UPF0754 membrane protein compare to other characterized membrane proteins in cyanobacteria?

The UPF0754 membrane protein differs from other characterized cyanobacterial membrane proteins such as SmpX, which belongs to the MIP (Major Intrinsic Protein) family. SmpX has been identified as a putative pore-forming protein involved in copper transport processes .

Cyanobacterial membrane proteins exhibit diverse functions and distributions:

Protein TypeLocalizationPrimary FunctionReference
Cytochrome oxidaseCytoplasmic membraneRespiratory electron transport
Carotenoprotein (P35)Cell wallStructural component
PSII proteins (D1, D2, CP43, CP47)Throughout thylakoidsPhotosystem II components
PSI reaction center proteinsOutermost thylakoid and cytoplasmic membranePhotosystem I components
ATP synthase proteinsOutermost thylakoid and cytoplasmic membraneATP generation
SmpX proteinMembrane-associatedPutative copper transport
UPF0754 (syc0451_d)Predicted membrane-associatedUnknown (possibly transport)

Unlike many photosynthetic proteins with well-defined localization and function, the UPF0754 membrane protein remains cryptic in its specific role and precise subcellular localization .

What experimental approaches are optimal for purification and functional characterization of recombinant syc0451_d?

Purification and functional characterization of the recombinant syc0451_d requires specialized approaches for membrane proteins:

Purification Strategy:

  • Expression optimization in E. coli with N-terminal His-tag for single-step affinity purification

  • Membrane fraction isolation via ultracentrifugation

  • Solubilization using appropriate detergents (e.g., n-dodecyl-β-D-maltoside, digitonin, or CHAPS)

  • Immobilized metal affinity chromatography (IMAC) purification

  • Size exclusion chromatography for further purification

Functional Characterization Approaches:

  • Reconstitution into proteoliposomes for transport assays

  • Electrophysiological measurements if ion channel activity is suspected

  • Binding assays with potential substrates

  • Isothermal titration calorimetry for binding kinetics

  • Fluorescence-based assays for conformational changes

The recombinant protein is typically provided as a lyophilized powder with >90% purity as determined by SDS-PAGE . For reconstitution, it is recommended to briefly centrifuge the vial prior to opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage . The addition of the His-tag facilitates purification while minimally impacting protein structure in most cases.

How can researchers optimize expression systems for obtaining functionally active syc0451_d protein?

Optimization of expression systems for membrane proteins like syc0451_d requires careful consideration of several variables:

Expression Host Selection:
Several expression systems are available for syc0451_d production:

Expression SystemAdvantagesDisadvantagesAvailable for syc0451_d
E. coliRapid growth, high yield, economicalMay not fold complex proteins properlyYes (CSB-EP689677FPZ1)
YeastPost-translational modifications, eukaryotic foldingLower yields, longer growth timeYes (CSB-YP689677FPZ1)
BaculovirusComplex protein folding, post-translational modificationsTechnical complexity, costYes (CSB-BP689677FPZ1)
Mammalian cellsNative-like folding, complex glycosylationHighest cost, lowest yieldYes (CSB-MP689677FPZ1)

Key Optimization Parameters:

  • Induction conditions (temperature, inducer concentration, timing)

  • Growth media composition

  • Co-expression with chaperones

  • Use of fusion partners to enhance solubility

  • Selection of appropriate detergents for solubilization

For functional activity retention, researchers should consider expressing the protein at lower temperatures (16-25°C) to slow folding and using specialized E. coli strains like C41(DE3) or C43(DE3) engineered for membrane protein expression . The recombinant protein has been successfully expressed with N-terminal His-tags in E. coli systems as documented in product specifications .

What analytical techniques are most effective for studying the membrane topology and oligomeric state of syc0451_d?

Determining membrane topology and oligomeric state of membrane proteins like syc0451_d requires sophisticated biophysical techniques:

Membrane Topology Analysis:

  • Cysteine scanning mutagenesis with membrane-impermeable thiol-reactive reagents

  • Protease protection assays

  • Fusion reporter approaches (PhoA/LacZ)

  • Cryo-electron microscopy

  • Site-directed fluorescence labeling

Oligomeric State Determination:

  • Blue native PAGE

  • Analytical ultracentrifugation

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

  • Chemical cross-linking followed by mass spectrometry

  • Single-particle electron microscopy

The methodological approach would typically involve expressing the protein with appropriate tags, purifying it in native conditions with suitable detergents, and applying combinations of these techniques to build a comprehensive structural model. For instance, researchers working with Synechococcus membrane proteins have successfully employed transmission electron microscopy with immunocytochemistry following freeze-substitution to maintain cellular morphology while detecting cellular antigens with high sensitivity .

What are the optimal storage and handling conditions for maintaining syc0451_d protein stability?

Maintaining stability of membrane proteins like syc0451_d requires careful attention to storage and handling conditions:

Storage Recommendations:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • After reconstitution, add glycerol to a final concentration of 5-50% (typically 50%) for long-term storage

  • Prepare working aliquots to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Buffer Considerations:

  • Tris/PBS-based buffer, pH 8.0 with 6% trehalose is recommended for storage

  • The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL

Critical Stability Factors:

  • Minimize freeze-thaw cycles as they can cause protein denaturation and aggregation

  • Temperature fluctuations should be avoided

  • Consider adding specific lipids that may stabilize the native conformation

  • Protease inhibitors may be necessary during purification and storage

Researchers should centrifuge the vial briefly before opening to bring contents to the bottom and follow reconstitution protocols precisely to maintain protein integrity .

How can researchers design experiments to elucidate potential interaction partners of syc0451_d in Synechococcus sp.?

Identifying interaction partners of membrane proteins requires specialized approaches:

In Vivo Approaches:

  • Co-immunoprecipitation with antibodies against syc0451_d

  • Proximity-dependent biotin identification (BioID)

  • Split-protein complementation assays

  • Genetic suppressor screens

  • Targeted gene deletion followed by phenotypic analysis

In Vitro Approaches:

  • Pull-down assays using recombinant His-tagged syc0451_d

  • Surface plasmon resonance

  • Isothermal titration calorimetry

  • Crosslinking mass spectrometry

  • Yeast two-hybrid screening (for soluble domains)

The availability of biotinylated versions of syc0451_d (e.g., CSB-EP689677FPZ1-B with Avi-tag Biotinylated) provides an excellent tool for pull-down experiments. The E. coli biotin ligase (BirA) covalently attaches biotin to the 15 amino acid AviTag peptide with high specificity, enabling efficient capture of protein complexes using streptavidin-based methods .

Researchers studying membrane protein interactions in Synechococcus sp. have successfully used immunocytochemistry coupled with electron microscopy to determine localization and potential interaction partners of membrane proteins, suggesting these techniques could be applied to syc0451_d as well .

What are the challenges and solutions for crystallization and structural determination of syc0451_d?

Membrane protein crystallization presents unique challenges:

Key Challenges:

  • Low expression yields

  • Protein instability outside of lipid environment

  • Detergent micelle interference with crystal contacts

  • Conformational heterogeneity

  • Phase determination difficulties

Strategic Solutions:

  • Protein Engineering Approaches:

    • Fusion with crystallization chaperones (e.g., T4 lysozyme)

    • Thermostabilizing mutations

    • Removal of flexible regions

    • Antibody fragment co-crystallization

  • Alternative Crystallization Methods:

    • Lipidic cubic phase crystallization

    • Bicelle-based crystallization

    • Vapor diffusion with specialized detergents

    • Microfluidic crystallization platforms

  • Non-crystallographic Methods:

    • Cryo-electron microscopy (increasingly preferred for membrane proteins)

    • NMR for smaller membrane proteins or domains

    • Computational modeling based on homologous structures

The recombinant syc0451_d protein with His-tag is available at >90% purity , providing a starting point for structural studies, though extensive optimization would likely be needed for successful crystallization trials. The availability of the protein in different expression systems (E. coli, yeast, baculovirus, mammalian) offers flexibility in selecting the most suitable source for structural studies.

What approaches can reveal the physiological role of syc0451_d in Synechococcus sp.?

Determining the physiological function of syc0451_d requires a multi-faceted approach:

Genetic Approaches:

  • Gene knockout/knockdown studies with phenotypic characterization

  • Complementation assays with wild-type and mutant variants

  • Overexpression studies to identify gain-of-function phenotypes

  • Conditional expression systems to study essential functions

  • Site-directed mutagenesis of conserved residues

Physiological Measurements:

  • Growth analysis under various environmental conditions

  • Measurement of transport activities (ions, metabolites)

  • Membrane potential and pH gradient analysis

  • Photosynthetic activity measurements if relevant

  • Stress response evaluations

Analyses of Synechococcus membrane proteins have revealed distinct localization patterns related to function. For example, cytochrome oxidase is localized almost entirely in the cytoplasmic membrane, while photosystem components show specific distributions in thylakoid membranes . Similar localization studies could provide insights into syc0451_d function.

How can researchers effectively compare syc0451_d with homologous proteins in other cyanobacteria?

Comparative analysis provides crucial evolutionary and functional insights:

Sequence-Based Approaches:

  • Multiple sequence alignment of homologs

  • Phylogenetic analysis to trace evolutionary relationships

  • Conservation analysis of specific domains or motifs

  • Identification of co-evolving residues

  • Genomic context analysis across species

Structural Comparison:

  • Homology modeling based on known structures

  • Conservation mapping onto structural models

  • Molecular dynamics simulations to compare dynamic properties

  • Docking studies with potential substrates

  • Electrostatic surface potential comparison

Functional Comparison:

  • Heterologous expression and complementation across species

  • Transport assays with standardized protocols

  • Comparative localization studies

  • Interactome analysis across species

  • Cross-species phenotypic analysis

The study of other Synechococcus membrane proteins has revealed interesting evolutionary relationships. For example, SmpX, another membrane protein from Synechococcus sp. PCC7942, belongs to the MIP family and shows higher similarity to eukaryotic homologs (like nodulin-26 from soybean) than to prokaryotic ones . This suggests unique evolutionary trajectories for cyanobacterial membrane proteins that might also apply to syc0451_d.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.