Recombinant Synechococcus sp. UPF0754 membrane protein SYNPCC7002_A1087 (SYNPCC7002_A1087)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SYNPCC7002_A1087; UPF0754 membrane protein SYNPCC7002_A1087
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-406
Protein Length
full length protein
Species
Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)
Target Names
SYNPCC7002_A1087
Target Protein Sequence
MNFWTLLLPPIAGTVIGYFTNDIAINMLFRPYKAIYIGDRRLPFTPGLIPANQDRLARNI SRIIMGSLLTPEEIQKLAQKLLQTERIEAAIRWLLQLAFAQIQGEQEQKTAGILAAILRD LASESLPRLIKVWSREDTFLEAQVYQIFDQLLLDFKLTEAQARQLTDWLLRTVLTPDILR QATIDFLTDKNIEIIDTSLREKTSGTYWVVANLFGVKNSLTRLRAFCLEEREIANARLQE LILTLEIRLKLRLWLQGLSLQNLPVSTVRQLRKSFHQTIRQYFQNKGAGLMEYIGESVDW DNLSVVILRRLQASQVLDSSLGVVSQELSLLLDRYLEKDLEKIISQVIPILAIDQVIIER VNNTSPRELERAIQGIVKNELQAIVNLGGVLGFLVGVAQSVILLLN
Uniprot No.

Target Background

Database Links
Protein Families
UPF0754 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is SYNPCC7002_A1087 and what is its function in Synechococcus sp.?

SYNPCC7002_A1087 is a UPF0754 family membrane protein found in the cyanobacterium Synechococcus sp. PCC 7002. This protein belongs to a class of uncharacterized protein families (UPF), specifically designated as UPF0754, indicating that its precise biological function remains to be fully elucidated. Based on bioinformatic analyses, it is predicted to be involved in membrane-associated processes that may be critical for the photosynthetic machinery or stress responses in cyanobacteria.

As a membrane protein, SYNPCC7002_A1087 likely participates in cellular processes such as signaling, transport, or structural maintenance of the thylakoid or cell membrane. Researchers should consider complementary approaches including gene knockout studies, protein-protein interaction analyses, and comparative genomics to establish its functional role.

What expression systems are most suitable for recombinant SYNPCC7002_A1087 production?

For membrane proteins like SYNPCC7002_A1087, the choice of expression system significantly impacts yield and functionality. While E. coli BL21(DE3) remains a common starting point, several considerations should guide system selection:

The table below summarizes key advantages and limitations of expression systems for SYNPCC7002_A1087:

Expression SystemAdvantagesLimitationsBest For
E. coli BL21(DE3)High yield, economical, high-cell-density systems available Possible improper folding, inclusion bodiesInitial expression trials
E. coli C41/C43Reduced toxicity for membrane proteinsLower yields than standard BL21Toxic membrane proteins
Pichia pastorisPost-translational modifications, proper foldingLonger timeline, more complex protocolsFunctionally sensitive constructs
Insect cellsComplex folding capabilityTime-consuming, expensiveProteins requiring extensive PTMs
Cell-free systemsAvoids toxicity issuesLimited scale, expensiveRapid screening, toxic proteins

How can I verify the successful expression of recombinant SYNPCC7002_A1087?

Verification of successful expression requires multiple complementary approaches:

  • Western blotting: Using antibodies against tag sequences (His, FLAG, etc.) or the protein itself if antibodies are available. This provides confirmation of the intact protein and its approximate molecular weight.

  • Mass spectrometry: Particularly useful for confirming the identity and integrity of the expressed protein. Techniques like MALDI-TOF or LC-MS/MS can verify the amino acid sequence.

  • Functional assays: Depending on predicted function, activity assays might include ligand binding, enzymatic activity, or interaction studies.

  • Localization studies: Confirming membrane localization using fractionation techniques or fluorescent fusion proteins.

  • Size exclusion chromatography: Useful for assessing the oligomeric state and homogeneity of the purified protein.

Implement orthogonal high-end analytical methods to characterize your purified protein, similar to the approach used for recombinant α-synuclein, which greatly improves reproducibility and reduces batch-to-batch variability .

What are the optimal conditions for solubilizing recombinant SYNPCC7002_A1087?

Solubilization of membrane proteins requires careful optimization of detergent conditions. For SYNPCC7002_A1087, consider the following methodological approach:

  • Detergent screening: Begin with a panel of detergents varying in harshness:

    • Mild detergents (DDM, LMNG, DMNG)

    • Intermediate detergents (DM, OG)

    • Harsh detergents (SDS, LDAO)

  • Concentration optimization: For each promising detergent, test a concentration range from 1-5x the critical micelle concentration (CMC).

  • Buffer composition: Screen pH ranges (typically 6.0-8.5), salt concentrations (100-500 mM NaCl), and stabilizing additives (glycerol 5-20%, specific lipids).

  • Temperature effects: Compare solubilization efficiency at 4°C vs. room temperature.

  • Alternative approaches: If traditional detergents yield poor results, consider:

    • Styrene-maleic acid lipid particles (SMALPs)

    • Amphipols

    • Nanodiscs

    • Membrane scaffold proteins

Create a systematic screening approach using a crossover experimental design to identify optimal conditions, similar to the strategy employed for recombinant α-synuclein purification described in current literature .

How can post-translational modifications of SYNPCC7002_A1087 be preserved in recombinant expression systems?

Preserving potential post-translational modifications (PTMs) of SYNPCC7002_A1087 requires strategic approaches:

  • PTM prediction and identification:

    • Utilize bioinformatic tools to predict potential modification sites

    • Confirm native modifications in the original Synechococcus species using MS/MS approaches

    • Target specific modifications based on biological relevance

  • Expression system selection based on PTM requirements:

    • Phosphorylation: Mammalian or insect cell systems

    • Glycosylation: Yeast (P. pastoris) or mammalian systems

    • Lipid modifications: Eukaryotic or native cyanobacterial systems

  • Co-expression strategies:

    • Include relevant kinases, phosphatases, or other modification enzymes

    • Supplement growth media with PTM substrates/precursors

  • Analytical validation:

    • Compare PTM profiles between native and recombinant proteins

    • Utilize high-resolution MS approaches (ETD, HCD fragmentation)

    • Consider site-directed mutagenesis to confirm PTM sites

Remember that batch-to-batch variability in PTMs can significantly impact protein function. Implement orthogonal analytical characterization methods as demonstrated for other recombinant proteins to ensure consistency across preparations .

What are the most effective purification techniques for maintaining SYNPCC7002_A1087 membrane protein functionality?

A strategic purification workflow for SYNPCC7002_A1087 should balance purity with functional preservation:

  • Initial capture:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged constructs

    • Consider utilizing a high-throughput, non-chromatographical approach for initial capture to improve reproducibility

  • Intermediate purification:

    • Ion exchange chromatography based on predicted pI

    • Size exclusion chromatography for removing aggregates

  • Polishing and validation:

    • Final SEC to confirm homogeneity

    • Activity assays at each purification stage to track functional preservation

  • Stability considerations:

    • Maintain detergent above CMC throughout purification

    • Consider addition of specific lipids to mimic native environment

    • Evaluate protein stability in detergent using thermal shift assays

  • Quality control metrics:

    • Implement a Gage Reproducibility and Repeatability (Gage R&R) validation approach

    • Use principal component analysis (PCA) to assess batch consistency

The table below provides a decision framework for purification strategy selection:

Purification GoalRecommended ApproachValidation Method
Maximum yieldDenaturing conditions with refoldingCircular dichroism, functional assays
Structural studiesGentle purification in stabilizing detergentsSEC-MALS, thermostability assays
Functional studiesNative-like conditions with lipid supplementationActivity assays, ligand binding
High-throughputNon-chromatographical methodsGage R&R validation

The implementation of a simple, high-throughput purification protocol validated through Gage R&R, as described for recombinant α-synuclein, could significantly facilitate research with higher reproducibility .

What controls should be included when studying SYNPCC7002_A1087 interactions with other proteins?

Robust interaction studies require comprehensive controls to distinguish genuine interactions from artifacts:

  • Negative controls:

    • Empty vector/tag-only expression constructs

    • Unrelated membrane proteins of similar size and topology

    • Detergent-only samples to identify detergent-mediated artifacts

  • Positive controls:

    • Known interaction partners (if any)

    • Artificially engineered interaction pairs

  • Validation approaches:

    • Reciprocal pull-downs with differently tagged constructs

    • Competition assays with unlabeled protein

    • Cross-validation using multiple interaction detection methods:

      • Co-immunoprecipitation

      • Surface plasmon resonance

      • Microscale thermophoresis

      • FRET/BRET approaches

      • Yeast two-hybrid (membrane-based variants)

  • Quantitative considerations:

    • Determine binding affinities (Kd values)

    • Assess stoichiometry of interactions

    • Measure association/dissociation kinetics

  • Environmental factors:

    • Test interactions under varying conditions (pH, salt, temperature)

    • Evaluate detergent/lipid dependence

Include orthogonal analytical methods for characterization and implement a crossover experimental design to increase reproducibility, similar to approaches used for other recombinant proteins .

How can isotope labeling be applied to SYNPCC7002_A1087 for structural studies?

Isotope labeling provides powerful tools for structural analysis of membrane proteins like SYNPCC7002_A1087:

  • NMR spectroscopy applications:

    • Uniform 15N and 13C labeling for backbone assignments

    • Selective amino acid labeling for specific structural regions

    • Deuteration strategies to reduce spectral complexity

    • TROSY-based approaches for larger membrane proteins

  • Labeling protocols:

    • Minimal media formulations with 15NH4Cl and 13C-glucose

    • Selective amino acid supplementation for specific labeling

    • Cell-free expression systems for difficult-to-express constructs

  • Specialized membrane protein considerations:

    • Detergent screening for optimal NMR spectra

    • Bicelle or nanodisc reconstitution for native-like environment

    • Specific labeling of interfacial regions

  • Mass spectrometry applications:

    • HDX-MS for dynamics and ligand binding

    • Crosslinking-MS for interaction interfaces

    • Footprinting approaches for accessibility mapping

  • Data analysis workflows:

    • Integration of multiple structural constraints

    • Molecular dynamics refinement of membrane protein models

    • Validation against evolutionary data

The complementary use of multiple analytical methods should be implemented to ensure reproducibility and reliability of structural data, as demonstrated in current literature for other recombinant proteins .

What are the considerations for designing mutagenesis experiments for SYNPCC7002_A1087?

Strategic mutagenesis can illuminate structure-function relationships in SYNPCC7002_A1087:

  • Target selection strategies:

    • Evolutionary conservation analysis

    • Structural motif identification

    • Homology model-guided targeting

    • Charged/polar residues at predicted interfaces

  • Mutation types and rationale:

    • Conservative substitutions (e.g., Asp→Glu) to preserve charge

    • Non-conservative substitutions to disrupt function

    • Alanine scanning of predicted functional domains

    • Cysteine substitutions for accessibility studies or crosslinking

  • Technical considerations:

    • Codon optimization for expression system

    • Verification of mutation incorporation

    • Assessment of mutation effects on protein stability

  • Functional readouts:

    • Expression level/folding efficiency

    • Membrane localization

    • Protein-protein interactions

    • Activity assays (based on predicted function)

  • Advanced approaches:

    • Unnatural amino acid incorporation

    • Double mutant cycle analysis for interaction networks

    • Temperature-sensitive mutants for conditional studies

Create a systematic mutation analysis using orthogonal high-end analytical methods to characterize the effects of each mutation, ensuring reproducibility and reducing experimental variability .

How can contradictory results in SYNPCC7002_A1087 functionality assays be reconciled?

Contradictory results are common in membrane protein research and require systematic reconciliation:

  • Source investigation:

    • Expression system variations

    • Purification method differences

    • Protein tag interference

    • Detergent/lipid environment effects

    • Batch-to-batch variability in protein preparations

  • Methodological standardization:

    • Implement Gage R&R to validate reproducibility across experiments

    • Standardize protein:detergent:lipid ratios

    • Control buffer components precisely

    • Normalize activity to protein concentration

  • Reconciliation strategies:

    • Direct comparison experiments under identical conditions

    • Identification of activity-modulating factors

    • Development of a unified experimental model

  • Statistical approaches:

    • Meta-analysis of multiple datasets

    • Identification of outliers and experimental artifacts

    • Multifactorial analysis to identify interaction effects

Laboratory-to-laboratory protocol variations often cause considerable variability and sometimes contradictory findings in protein research . Implementing validated, reproducible protocols like those developed for other recombinant proteins could significantly reduce such discrepancies.

What statistical approaches are most appropriate for analyzing SYNPCC7002_A1087 binding data?

Robust statistical analysis ensures reliable interpretation of binding data:

  • Model selection:

    • One-site vs. multi-site binding models

    • Cooperative binding analysis

    • Kinetic vs. equilibrium approaches

    • Competitive vs. non-competitive inhibition

  • Fitting procedures:

    • Non-linear regression techniques

    • Global fitting of multiple datasets

    • Bayesian approaches for complex models

    • Bootstrapping for confidence interval estimation

  • Quality metrics:

    • Residual analysis for systemic deviations

    • F-test for model comparison

    • AIC/BIC criteria for model selection

    • Monte Carlo simulations for error estimation

  • Visualization approaches:

    • Scatchard/Hanes-Woolf linearizations

    • Hill plots for cooperativity assessment

    • Dose-response visualization

    • Kinetic association/dissociation plots

  • Advanced considerations:

    • Principal Component Analysis (PCA) for multivariate data

    • Machine learning approaches for complex datasets

    • Time series analysis for kinetic data

Employ statistical validation methods like Gage R&R to ensure reproducibility across experiments and reduce batch-to-batch variability that might obscure genuine biological effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.