Recombinant Synechocystis sp. Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Synechocystis sp. Apocytochrome f (petA)

Recombinant Synechocystis sp. Apocytochrome f (petA) refers to the genetically modified form of apocytochrome f, a protein encoded by the petA gene in the cyanobacterium Synechocystis sp. PCC 6803 . Apocytochrome f is a core subunit of the cytochrome b6f complex, which is essential for photosynthetic electron transfer . Genetic engineering techniques are employed to modify Synechocystis sp. to enhance specific traits or study the function and regulation of petA and its product .

Role of Apocytochrome f in Synechocystis sp.

Apocytochrome f plays a crucial role in the photosynthetic electron transport chain . Specifically, it is a component of the cytochrome b6f complex, which mediates electron transfer between photosystem II and photosystem I . This complex is integral to generating the proton gradient across the thylakoid membrane, which drives ATP synthesis .

Genetic Manipulation of petA

Researchers have used various methods to manipulate the petA gene in Synechocystis sp. PCC 6803:

  • Gene Deletion and Disruption: Studies have involved deleting or disrupting the petA gene to investigate the consequences on cytochrome b6f complex assembly and photosynthetic function .

  • Heterologous Expression: The petA gene has been expressed in conjunction with other genes to study metabolic pathways and improve specific traits, such as arabinose utilization .

  • Promoter Modification: The native promoter of petA has been replaced with other promoters, such as the psbA2 promoter, to control the expression levels of apocytochrome f .

Research Findings and Applications

Studies involving recombinant Synechocystis sp. Apocytochrome f (petA) have yielded several significant findings:

Examples of Recombinant petA Studies

  • Arabinose Utilization: Expression of petA was tested as a positive control in a study aimed at boosting the utilization of L-arabinose in Synechocystis. The introduction of the AraJ transporter from E. coli enhanced L-arabinose consumption and biomass production in the recombinant strain .

  • FtsH Protease Complex: The expression of petA was monitored in studies investigating the role of the FtsH1/3 protease complex in response to nutrient stress. It was found that the FtsH1/3 complex is critical for acclimation to iron, phosphate, and carbon stress .

  • Cytochrome c Maturation: Research on cytochrome c maturation involved creating a mutant lacking the first 24 codons of the ccsB gene, which led to the accumulation of unprocessed apocytochrome f .

  • Transcriptional Phenocopy: Studies using microarray analysis revealed that the expression of petA is affected by various stress conditions, including high light and oxidative stress, indicating its role in the broader stress response network of Synechocystis .

  • Xylose Uptake: Recombinant Synechocystis strains were engineered to improve xylose uptake. The expression of petA was used as a positive control to confirm gene insertion .

Data Tables

ExperimentMeasurementWild TypeRecombinant Strain
Photosynthetic Rate$$O_2$$ Production (µmol $$O_2$$ /mg Chl/h)XY
Cytochrome b6f Complex AbundanceRelative UnitsAB
L-Arabinose Consumptionmmol/LPQ
Transcript Levels of petA (qRT-PCR)Relative ExpressionRS
Biomass Yieldg/LUV
Growth Rate (μ\mu)/hWZ

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you require a specific format, please specify this during order placement.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; sll1317; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
45-328
Protein Length
Full Length of Mature Protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
petA
Target Protein Sequence
YPFWAQETAPLTPREATGRIVCANCHLAQKAAEVEIPQAVLPDTVFEAVVKIPYDLDSQQ VLGDGSKGGLNVGAVLMLPEGFKIAPPDRLSEGLKEKVGGTYFQPYREDMENVVIVGPLP GEQYQEIVFPVLSPDPAKDKSINYGKFAVHLGANRGRGQIYPTGLLSNNNAFKAPNAGTI SEVNALEAGGYQLILTTADGTETVDIPAGPELIVSAGQTVEAGEFLTNNPNVGGFGQKDT EVVLQNPTRIKFLVLFLAGIMLSQILLVLKKKQIEKVQAAELNF
Uniprot No.

Target Background

Function

Recombinant Synechocystis sp. Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Database Links
Protein Families
Cytochrome f family
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is the role of cytochrome f (petA gene product) in Synechocystis sp. PCC 6803?

Cytochrome f is an essential component of the cytochrome b6f complex in the photosynthetic electron transport chain of Synechocystis sp. PCC 6803. It functions as an electron carrier, mediating electron transport from the cytochrome b6f complex to photosystem I. The cytochrome b6f complex acts as a central hub in both linear electron transport (LET) and cyclic electron transport (CET) .

The complex exhibits a dimeric structure containing multiple subunits including cytochrome f (PetA), cytochrome b6, the Rieske iron-sulfur protein, and subunit IV, along with smaller subunits such as PetG, PetM, PetN, and PetL . The proper assembly and functioning of this complex is crucial for photosynthetic efficiency and energy production in the cyanobacterium.

How is apocytochrome f processed to mature cytochrome f in Synechocystis?

The maturation of apocytochrome f to functional cytochrome f involves several key steps:

  • Translation and membrane targeting: The petA gene is translated into apocytochrome f, which contains an N-terminal signal peptide.

  • Signal peptide processing: Leader peptidase LepB1 (encoded by sll0716) is primarily responsible for cleaving the signal peptide from apocytochrome f. While LepB2 (slr1377) can partially compensate, the processing is most efficient with LepB1 .

  • Heme attachment: The CcsB protein (similar to Ccs1 in Chlamydomonas reinhardtii) is involved in the covalent attachment of heme to the apoprotein. This process requires the transport of heme and its proper orientation for attachment to specific cysteine residues .

  • Complex assembly: The mature cytochrome f is then incorporated into the cytochrome b6f complex along with other subunits.

Mutations in genes involved in this maturation pathway can result in the accumulation of unprocessed apocytochrome f in the membrane fraction, affecting photosynthetic efficiency .

What phenotypes are observed in petA mutants of Synechocystis?

Mutations in the petA gene or in genes affecting cytochrome f maturation lead to several observable phenotypes:

  • Growth defects: Strains with compromised cytochrome f function often show reduced photoautotrophic growth, particularly under high light conditions .

  • Altered electron transport: Measurements of photosynthetic electron transport rates show reduced efficiency in the electron transfer from PSII to PSI.

  • Membrane accumulation: In some cases, unprocessed apocytochrome f accumulates in the membrane fraction, as observed in CcsB mutants (e.g., the ΔM1-A24 mutant lacking the first 24 codons of ccsB) .

  • Anaerobic growth requirement: Some cytochrome f maturation mutants can only grow under anaerobic conditions, suggesting that oxygen toxicity may occur when electron transport is impaired .

  • Light sensitivity: Imbalance in the ratios of PSI and cytochrome b6f to PSII can lead to extreme light sensitivity due to imbalanced photosynthetic electron flow .

What strategies are used to create recombinant petA constructs in Synechocystis?

Several effective strategies for generating recombinant petA constructs include:

  • Affinity tag addition: The petA gene can be modified to include sequences encoding affinity tags, such as Strep-tag II, for protein purification. This typically involves designing a construct with:

    • The petA gene with the tag sequence inserted at the 3' end

    • A selective marker (e.g., chloramphenicol resistance)

    • Homologous regions flanking the insertion site (~500 bp) for targeted recombination

  • Overlap extension PCR (OLE-PCR): This technique efficiently joins multiple DNA fragments:

    • First fragment: 3' end of petA fused to linker-tag sequence

    • Second fragment: Antibiotic resistance gene (e.g., cat gene)

    • Third fragment: Homologous region downstream of petA

    • PCR primers for joining these fragments and creating the final linear product

  • Homologous recombination: The final construct is introduced into wild-type Synechocystis through natural transformation. Transformants are selected by plating on medium containing the appropriate antibiotic with increasing concentrations to ensure full segregation .

The resulting strains should be verified by PCR with primers flanking the insertion site and by sequencing the modified petA gene region to confirm the correct modification.

How can researchers purify and analyze the cytochrome b6f complex containing modified cytochrome f?

A comprehensive protocol for purification and analysis includes:

  • Cell growth and harvesting:

    • Cultivate cells in 8-32L cultures under appropriate light and temperature conditions

    • Harvest by centrifugation (14,334×g, 10 min, 4°C)

    • Resuspend in appropriate buffer (e.g., 25 mM sodium phosphate pH 7.6, 10 mM MgCl2, 50 mM NaCl, 10% glycerol)

  • Cell lysis and membrane isolation:

    • Disrupt cells using bead beating (0.1 mm glass beads, 8 rounds of 55s cycles with 3 min cooling on ice between cycles)

    • Remove unbroken cells by centrifugation (4,696×g, 20 min, 4°C)

    • Isolate thylakoid membranes by centrifugation (48,400×g, 30 min, 4°C)

  • Solubilization and affinity purification:

    • Solubilize membranes using appropriate detergents

    • If using Strep-tagged cytochrome f, apply to Strep-Tactin columns

    • Wash extensively and elute with desthiobiotin

  • Analysis methods:

    • SDS-PAGE: Verify subunit composition using Coomassie staining

    • Native-PAGE: Assess oligomeric state (primarily dimeric)

    • Absorption spectroscopy: Measure spectra after reduction with sodium ascorbate and sodium dithionite (peaks at 558 nm for heme f and 564 nm for heme b)

    • Cryo-EM: Determine structure of the complex and interaction with other proteins

Spectroscopic FeaturesAbsorption Maximum (nm)
Heme f558
Heme b564

What approaches can be used to reconstitute protein-protein interactions with the cytochrome b6f complex?

Several methods have proven effective for reconstituting and studying protein-protein interactions:

  • In vitro reconstitution using affinity chromatography:

    • Express and purify interaction partners separately (e.g., His6-tagged PetP and StrepII-tagged cytb6f)

    • Immobilize one partner on an affinity resin (e.g., His6-tagged PetP on Ni2+ resin)

    • Apply the second protein (e.g., purified cytb6f complex)

    • Wash to remove non-specific interactions

    • Co-elute the complex and verify by SDS-PAGE and spectroscopic analysis

  • Pull-down assays from solubilized membranes:

    • Express tagged proteins (e.g., His-tagged PetP)

    • Solubilize thylakoid membranes containing cytb6f

    • Perform pull-down experiments to capture interaction partners

    • Include appropriate controls to rule out non-specific binding

  • Cross-linking approaches:

    • Use chemical cross-linkers to capture transient interactions

    • Analyze cross-linked products by mass spectrometry

    • Validate interactions through comparative structural analysis

The interaction between cytochrome b6f and PetP has been successfully studied using these approaches, revealing that PetP binds to the cytoplasmic face of the complex and may modulate the balance between linear and cyclic electron transport .

How does the structure of the cytochrome b6f complex influence its function in electron transport?

The structure-function relationship of the cytochrome b6f complex reveals several important aspects:

  • Subunit organization: Cryo-EM structures show that the complex exists primarily as a dimer with each monomer containing cytochrome b6 (green), cytochrome f (pink), Rieske ISP (yellow), subunit IV (cyan), and several smaller subunits (PetG, PetM, PetN, PetL) .

  • Cofactor positions: The complex contains multiple redox-active cofactors:

    • Heme f in cytochrome f

    • Hemes b and cn in cytochrome b6

    • Iron-sulfur cluster in the Rieske protein

    The distances between these cofactors are critical for efficient electron transfer. For example, the distance between the nearest edge of PetP and the edge of heme cn Fe is 15.9 Å .

  • Interaction surfaces: The cytochrome b6f complex has distinct binding surfaces for electron donors and acceptors:

    • The PetP binding site at the cytoplasmic face overlaps with the predicted ferredoxin docking site

    • This positioning suggests a role in regulating the balance between linear and cyclic electron transport

  • Conformational changes: The binding of PetP displaces the C-terminus of the PetG subunit, which moves away from subunit IV to accommodate PetP. These structural changes may contribute to regulating electron flow through the complex .

Understanding these structural features provides insight into how the complex mediates electron transport and how it might be modulated by interactions with proteins like PetP.

What is the relationship between cytochrome f maturation and copper-responsive gene expression in Synechocystis?

The relationship between cytochrome f maturation and copper-responsive gene expression involves complex regulatory mechanisms:

  • Alternative electron carriers: In Synechocystis, electron transport from the cytochrome b6f complex to photosystem I can be mediated by either cytochrome c553 (encoded by petJ) or plastocyanin (encoded by petE). The choice between these carriers is regulated by copper availability .

  • Transcriptional regulation: The expression of petJ (cytochrome c553) and petE (plastocyanin) is controlled by copper:

    • In copper-deficient conditions, petJ is expressed and petE is repressed

    • In copper-sufficient conditions, petE is induced and petJ is repressed

  • Regulatory mechanism: This copper-dependent regulation involves:

    • A transcription factor (PetR) that activates petJ and represses petE

    • A membrane protease (PetP) that degrades PetR in the presence of copper

    • This creates a copper-responsive switch between the two electron carriers

  • Integration with cytochrome f processing: The proper processing of cytochrome f by leader peptidases (particularly LepB1) ensures the efficiency of electron transport regardless of which carrier (cytochrome c553 or plastocyanin) is used .

This copper-responsive system allows Synechocystis to adapt to varying copper availability in the environment while maintaining efficient photosynthetic electron transport.

How do mutations in leader peptidases affect cytochrome f processing and photosynthetic complex assembly?

Mutations in leader peptidases have significant impacts on cytochrome f processing and photosynthetic function:

  • LepB1 vs. LepB2 roles: Synechocystis possesses two leader peptidases (LepB1 and LepB2). Deletion of the gene for LepB1 (sll0716) results in:

    • Inability to grow photoautotrophically

    • Extreme light sensitivity

    • Impaired accumulation of both PSI and cytochrome b6f complexes

  • Differential processing effects:

    • PsaF (PSI subunit) processing is completely dependent on LepB1

    • Cytochrome f (PetA) processing can be partially performed by LepB2, but is much more efficient with LepB1

    • PsbO (PSII subunit) processing can also be partially performed by LepB2

  • Photosynthetic complex assembly impacts:

    • In LepB1 mutants, PsaF is incorporated into PSI in its unprocessed form, affecting PSI assembly/stability

    • The amount of assembled PSII remains unchanged despite slower processing of PsbO

    • This creates an imbalance in the PSI:PSII and cytb6f:PSII ratios, leading to imbalanced photosynthetic electron flow

  • Secondary effects: Proteomics analysis of leader peptidase mutants reveals broader impacts:

    • Strong induction of the CydAB oxidase (alternative respiratory pathway)

    • Significant decrease in phycobiliproteins

    • Reduced levels of chlorophyll/heme biosynthesis enzymes

These findings indicate that proper signal peptide processing by leader peptidases is crucial for the correct assembly and balance of photosynthetic complexes.

What techniques are most effective for monitoring cytochrome f expression and processing in vivo?

Several complementary techniques are effective for monitoring cytochrome f expression and processing:

These techniques provide complementary information about cytochrome f expression, processing, incorporation into the cytochrome b6f complex, and functional activity.

What are the optimal conditions for expressing and purifying recombinant cytochrome f from Synechocystis?

Optimal conditions for expression and purification of recombinant cytochrome f include:

  • Growth conditions:

    • Temperature: 30°C

    • Light: 40-50 μmol photons m^-2 s^-1 (moderate light intensity)

    • Media: BG-11 supplemented with appropriate antibiotics

    • Growth phase: Late exponential (OD730 of 0.8-1.0)

    • Culture volume: 8-32L for sufficient yield

  • Strain engineering considerations:

    • C-terminal affinity tags (Strep-tag II) are preferable to N-terminal tags that might interfere with signal peptide processing

    • Full segregation must be confirmed by PCR to ensure homogeneous expression

    • Antibiotic pressure should be maintained throughout culturing

  • Purification strategy:

    • Membrane preparation: Gentle cell disruption followed by differential centrifugation

    • Solubilization: Critical step using mild detergents (e.g., n-dodecyl β-D-maltoside at 1% w/v)

    • Affinity chromatography: Using the specific affinity tag (e.g., Strep-Tactin for Strep-tag II)

    • Buffer composition: 25 mM sodium phosphate pH 7.6, 10 mM MgCl2, 50 mM NaCl, 10% glycerol, plus appropriate detergent

  • Quality control assessments:

    • SDS-PAGE: To confirm purity and correct molecular weight

    • Native-PAGE: To assess oligomeric state

    • Absorption spectroscopy: To confirm proper heme incorporation

    • Mass spectrometry: To verify correct processing and modifications

These conditions maximize yield while preserving the structural integrity and functional properties of the cytochrome b6f complex.

How can cryo-EM be effectively used to study the structure of cytochrome b6f complex with associated proteins?

Cryo-EM has become an invaluable tool for studying membrane protein complexes like cytochrome b6f. Key methodological considerations include:

  • Sample preparation:

    • Purity: Highly homogeneous preparations are essential (>95% purity)

    • Concentration: Typically 2-5 mg/ml for membrane proteins

    • Detergent choice: Critical for maintaining native structure while providing contrast (typically DDM or LMNG)

    • Reconstitution: For studying interactions, in vitro reconstitution of the complex with binding partners prior to grid preparation

  • Grid preparation optimizations:

    • Vitrification conditions: Including blotting time, humidity, and temperature

    • Support films: Use of gold grids with thin carbon support film

    • Additives: Like fluorinated detergents or amphipols can improve particle distribution and orientation

  • Data collection strategy:

    • Microscope settings: Voltage (typically 300 kV), magnification, and dose

    • Motion correction: Collect movies rather than single images

    • Automated collection: Software like SerialEM for efficient data acquisition

  • Image processing workflow:

    • Particle picking: Automated with manual supervision

    • 2D classification: To eliminate poor particles

    • 3D reconstruction: Using appropriate algorithms (e.g., RELION)

    • Model building: Fitting existing structures and refining

  • Validation approaches:

    • Resolution assessment: FSC curves at different thresholds

    • Model validation: Geometric and stereochemical parameters

    • Map-to-model correlation: Ensuring good fit between density and model

The cytochrome b6f complex with bound PetP has been successfully studied using cryo-EM, revealing detailed interaction sites and conformational changes upon binding .

How can researchers distinguish between linear and cyclic electron transport contributions in Synechocystis with modified petA?

Distinguishing between linear electron transport (LET) and cyclic electron transport (CET) requires multiple complementary approaches:

  • Spectroscopic measurements:

    • P700 redox kinetics: Measure the re-reduction rate of oxidized P700 (the PSI reaction center) in the presence/absence of PSII inhibitors like DCMU

    • Chlorophyll fluorescence induction: Analysis of post-illumination fluorescence rise can indicate CET activity

  • Oxygen measurements:

    • Clark-type electrode: Measure oxygen evolution rates with different electron acceptors

    • Membrane inlet mass spectrometry (MIMS): Distinguishes between oxygen evolution and consumption

  • Experimental manipulations:

    • DCMU treatment: Blocks PSII, allowing isolation of CET activity

    • Specific inhibitors: Such as antimycin A (affects some CET pathways)

    • Electron acceptor addition: Artificial acceptors like methyl viologen can drain electrons from PSI, inhibiting CET

  • Genetic approaches:

    • Marker gene expression: Genes specifically regulated by the redox state of electron carriers

    • Mutant analysis: Compare with strains lacking specific components of LET or CET pathways

  • Quantitative analysis:

    • Calculate the quantum yield of PSI (Y(I)) and PSII (Y(II))

    • The Y(I)/Y(II) ratio >1 suggests significant CET contribution

For petA-modified strains, it's particularly informative to compare these measurements under different light qualities and intensities, as the redox state of the plastoquinone pool (most reduced under red light) significantly affects the balance between LET and CET .

What are common challenges in creating fully segregated petA mutants and how can they be overcome?

Creating fully segregated petA mutants in Synechocystis presents several challenges:

  • Essential gene considerations:

    • petA is essential for photoautotrophic growth, making complete deletion difficult

    • Strategy: Use conditional mutants or modify the gene while maintaining function

  • Segregation difficulties:

    • Challenge: Synechocystis contains multiple genome copies (10-12 per cell)

    • Solution: Extended selection with increasing antibiotic concentrations

    • Protocol example: Start with 12.5 μg/ml chloramphenicol and increase to 68 μg/ml through sequential transfers

  • Verification methods:

    • PCR screening: Design primers spanning the modified region

    • Expected outcome: Wild-type cells show a ~1.2 kb band, while fully segregated mutants show a larger band (e.g., ~4 kb with inserted cassette)

    • Sequencing: Confirm the exact sequence of the modified region

  • Functional impairment:

    • Challenge: Modifications affecting function can create selective pressure against segregation

    • Solution: Use tag positions that minimally affect function (e.g., C-terminal tags)

    • Alternative: Create glucose-tolerant backgrounds that permit heterotrophic growth

  • Genotype instability:

    • Challenge: Reversion to wild-type under non-selective conditions

    • Solution: Maintain antibiotic selection throughout experiments

    • Monitoring: Regular PCR verification of culture genotype

By addressing these challenges with appropriate strategies, researchers can successfully create and maintain fully segregated petA mutants for various studies.

How can researchers troubleshoot issues with cytochrome f maturation and complex assembly?

When facing issues with cytochrome f maturation and complex assembly, researchers should consider the following troubleshooting approaches:

  • Expression level problems:

    • Symptom: Low or undetectable cytochrome f

    • Diagnostic approaches:

      • RT-qPCR to check transcript levels

      • Western blotting for protein detection

    • Solutions:

      • Optimize promoter strength

      • Check for premature transcription termination

      • Verify codon usage compatibility

  • Processing defects:

    • Symptom: Accumulation of unprocessed apocytochrome f

    • Diagnostic approaches:

      • Western blotting to detect size difference

      • Mass spectrometry to confirm processing state

    • Solutions:

      • Check leader peptidase function (LepB1/LepB2)

      • Verify signal sequence is correctly designed

      • Consider co-expression of processing machinery

  • Heme attachment issues:

    • Symptom: Protein present but lack of characteristic spectral features

    • Diagnostic approaches:

      • Absorption spectroscopy (absence of 558 nm peak)

      • Heme staining of SDS-PAGE gels

    • Solutions:

      • Verify CcsB functionality

      • Ensure adequate heme biosynthesis

      • Check for mutations in heme attachment sites

  • Complex assembly problems:

    • Symptom: Cytochrome f present but not incorporated into functional b6f complex

    • Diagnostic approaches:

      • Blue native PAGE to assess complex formation

      • Activity assays (plastoquinol oxidation)

    • Solutions:

      • Check expression of other complex components

      • Optimize growth conditions (light, temperature)

      • Consider impacts of membrane composition

  • Functional deficiencies:

    • Symptom: Complex formed but with reduced activity

    • Diagnostic approaches:

      • Electron transport measurements

      • Growth phenotype assessment

    • Solutions:

      • Check for mutations affecting key residues

      • Verify correct stoichiometry of complex components

      • Assess interaction with electron transfer partners

By systematically addressing these potential issues, researchers can effectively troubleshoot problems with cytochrome f maturation and complex assembly in recombinant systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.