Recombinant Synechocystis sp. ATP-dependent zinc metalloprotease FtsH 3 (ftsH3)

Shipped with Ice Packs
In Stock

Description

Introduction

FtsH proteases are ATP-dependent zinc metalloproteases found in prokaryotes, mitochondria, and chloroplasts of eukaryotic cells . These proteases play a crucial role in maintaining protein quality and homeostasis by degrading misfolded, damaged, or unneeded membrane proteins . In Synechocystis sp. PCC 6803 (Synechocystis), a model cyanobacterium, four FtsH homologs (FtsH1 to FtsH4) have been identified . FtsH3 is a component of two distinct hetero-oligomeric complexes: FtsH2/3 and FtsH1/3 . The FtsH2/3 complex is involved in the quality control of photosystem II (PSII) in thylakoid membranes, while the FtsH1/3 complex, localized in cytoplasmic membranes, is essential for cell viability and plays a role in iron homeostasis .

Structure and Function of FtsH Proteases

FtsH is an ATP-dependent zinc metalloprotease complex that belongs to the AAA (ATPase associated with diverse cellular activities) protease subfamily and is unique because it is membrane anchored . The general structure of FtsH complexes involves a hexameric arrangement of protomers, forming a hexagonal particle with a central pore . Each protomer consists of a transmembrane domain, an ATPase domain, and a protease domain . The ATPase domain functions as an unfoldase, translocating substrates into the degradation chamber through the narrow pore . The protease domain contains the active site where the target polypeptide chain is cleaved .

FtsH3 in Synechocystis

In Synechocystis, FtsH3 participates in two different complexes, each with distinct functions :

  • FtsH2/3 Complex: This complex, along with FtsH2 (Slr0228), is primarily involved in the quality control of Photosystem II (PSII) within the thylakoid membranes .

  • FtsH1/3 Complex: This complex, along with FtsH1 (Slr1390), is essential for cell viability and is located in the cytoplasmic membranes. It plays a crucial role in acclimation to iron deficiency by controlling the level of the ferric uptake regulator Fur .

Role in Nutrient Stress Acclimation

The FtsH1/3 complex is critical for the acclimation of Synechocystis to nutrient stress, including iron, phosphate, carbon, and nitrogen starvation . Depletion of FtsH1/3 leads to a significant reduction in the transcriptional response to nutrient stress, affecting regulons such as Fur, Pho, NdhR, and NtcA . This effect is accompanied by the accumulation of the respective transcription factors, indicating that FtsH1/3 is essential for mounting a full transcriptional response to these nutrient stress conditions .

Experimental Evidence

Genome-wide expression profiling and proteomic analyses of Synechocystis mutants with conditional depletion of FtsH3 or FtsH1 have provided insights into the physiological roles of FtsH hetero-complexes . For example, in the FtsH3down mutant, the expression of ftsH3 is controlled by the nirA promoter, which is downregulated by ammonium ions (NH4+) . The presence of 13 mM NH4+ in the medium suppresses ftsH3 expression, leading to a significant decrease in the levels of both FtsH2/3 and FtsH1/3 protein complexes . Similarly, in the FtsH1down mutant, the expression of ftsH1 is controlled by the petJ promoter, which is downregulated in the presence of copper ions . The presence of 0.8 µM Cu2+ ions in the medium leads to a decline in ftsH1 transcript levels, resulting in a decrease in the level of the FtsH1/3 complex .

Molecular Mechanism of Proteolysis

FtsH complexes conduct ATP-dependent proteolysis by unfolding and translocating the target substrate through the central pore of the ATPase complex to the protease domain for degradation . A flexible linker between the transmembrane and ATPase domains creates space for substrates to access the protease . A phenylalanine residue, positioned on the top surface near the central pore of the ATPase domain, is responsible for substrate binding .

Tables Summarizing Key Findings

FeatureDescription
ProteinFtsH3 (ATP-dependent zinc metalloprotease)
OrganismSynechocystis sp. PCC 6803
HomologsFtsH1, FtsH2, FtsH4
ComplexesFtsH2/3 (Photosystem II quality control), FtsH1/3 (Iron homeostasis, nutrient stress acclimation)
FunctionProtein quality control, degradation of damaged proteins, regulation of transcription factors, acclimation to nutrient stress
EssentialityFtsH1/3 complex is essential for cell viability
RegulationExpression regulated by nutrient availability (iron, phosphate, carbon, nitrogen)
ATPase-dependent proteolysisUnfolding and translocation of target substrate through the central pore of the ATPase complex to the protease domain for degradation

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your own preparations.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
ftsH3; slr1604; ATP-dependent zinc metalloprotease FtsH 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-616
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
ftsH3
Target Protein Sequence
MSKNNKKWRNAGLYALLLIVVLALASAFFDRPTQTRETLSYSDFVNRVEANQIERVNLSA DRTQAQVPNPSGGPPYLVNLPNDPDLINILTQHNVDIAVQPQSDEGFWFRIASTLFLPIL LLVGIFFLFRRAQSGPGSQAMNFGKSKARVQMEPQTQVTFGDVAGIEQAKLELTEVVDFL KNADRFTELGAKIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSEFVEMFVGVGAS RVRDLFEQAKANAPCIVFIDEIDAVGRQRGAGLGGGNDEREQTLNQLLTEMDGFEGNTGI IIVAATNRPDVLDSALMRPGRFDRQVVVDRPDYAGRREILNVHARGKTLSQDVDLDKIAR RTPGFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLV AYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAV ALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQGGGVFLG RDIASDRDFSDETAAAIDEEVSQLVDQAYQRAKQVLVENRGILDQLAEILVEKETVDSEE LQTLLANNNAKLALLV
Uniprot No.

Target Background

Function
This recombinant Synechocystis sp. ATP-dependent zinc metalloprotease FtsH3 (ftsH3) functions as a processive, ATP-dependent zinc metallopeptidase, acting on both cytoplasmic and membrane proteins. It plays a crucial role in the quality control of integral membrane proteins.
Database Links
Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein; Stromal side. Note=Some is found associated with photosystem II.

Q&A

What is FtsH3 and what is its basic structural organization in Synechocystis?

FtsH3 is an ATP-dependent zinc metalloprotease that forms hetero-oligomeric complexes in the cyanobacterium Synechocystis. Three-dimensional structural analysis at 26 Å resolution revealed that FtsH3 forms part of a hexameric complex with FtsH2, with subunits arranged in an alternating FtsH2/FtsH3 pattern . This structural arrangement is crucial for proper proteolytic function and cellular regulation.

In Synechocystis, FtsH3 can also form a complex with FtsH1 (designated as the FtsH1/3 complex), which plays important roles in stress response pathways. The formation of these specific protease complexes allows for targeted protein quality control within distinct cellular compartments and under different environmental conditions .

Is FtsH3 essential for Synechocystis viability and what happens when it's depleted?

Yes, the ftsH3 gene is vital for cell viability in Synechocystis sp. PCC 6803 . Experimental depletion of FtsH3 using regulatable promoter systems demonstrates severe physiological consequences. Within 3-4 days of FtsH3 depletion, cells exhibit:

  • Near-complete growth arrest

  • Decreased cellular chlorophyll a content

  • Reduced photosystem II (PSII) oxygen-evolving activity

  • Impaired degradation of the D1 protein during high light stress

  • Parallel loss of both FtsH2 and FtsH3 proteins

These findings indicate that FtsH3 is not only essential for normal growth but also plays critical roles in photosystem maintenance and stress response mechanisms.

What genetic systems are available for studying FtsH3 function in cyanobacteria?

Several genetic systems have been developed to regulate and study FtsH3 function in Synechocystis:

  • FtsH3down system: Utilizes the nirA promoter to control ftsH3 expression, which can be downregulated by adding ammonium ions (NH4+) to the growth medium. Addition of 13 mM NH4+ suppresses ftsH3 expression approximately eightfold, resulting in significant decrease of both FtsH2/3 and FtsH1/3 protein complexes .

  • SynFtsH3reg system: Involves deletion of the chromosomal ftsH3 copy while maintaining a plasmid-borne copy driven by the nirA promoter. This allows for controlled depletion of FtsH3 upon addition of 13 mM NH4+ to the medium .

  • FtsH1down system: Uses the petJ promoter to regulate ftsH1 expression, which is downregulated by copper ions. Addition of 0.8 μM Cu2+ to the medium results in sixfold reduction of ftsH1 transcript levels and significant decrease in FtsH1/3 complex abundance .

  • FtsH1over system: Generates approximately eight-fold higher levels of FtsH1 protein, enabling studies on the effects of FtsH1 overexpression .

These systems allow researchers to systematically investigate FtsH3 function by controlled depletion or overexpression of relevant proteins.

What techniques are most effective for studying FtsH3 protein-protein interactions?

Multiple complementary techniques have proven effective for investigating FtsH3 interactions:

  • Co-immunoprecipitation (Co-IP): Effectively identifies in vivo protein complexes. For example, Co-IP using FLAG-tagged CI subunit B14.7 allowed detection of FTSH3 association with Complex I in Arabidopsis, confirming interaction between these complexes .

  • Yeast-2-hybrid (Y2H) assays: Determine direct protein-protein interactions. Y2H demonstrated direct interaction between FTSH3 and PSST (a CI subunit) and identified specific mutations (P415L in FTSH3 or S70F in PSST) that disrupt this interaction .

  • Bimolecular fluorescence complementation (BiFC): Visualizes protein interactions in living cells, providing spatial information about interaction sites .

  • Two-dimensional gel analysis: Combines clear native (CN) and SDS-PAGE to analyze protein complexes under various conditions, particularly useful for studying the effects of nutrient stress on FtsH complex formation and stability .

  • Whole-cell label-free quantitative proteomics: Provides a comprehensive analysis of protein abundance changes in response to FtsH3 depletion or environmental stresses .

How can researchers analyze the effects of FtsH3 depletion on gene expression?

Genome-wide transcriptomic and proteomic approaches have been successfully employed:

  • Transcriptome analysis: RNA sequencing of FtsH3-depleted strains under various nutrient conditions identified differential expression of genes involved in nutrient stress response, photosynthesis, and other cellular processes. In one study, 1187 transcripts were identified as FtsH-dependent and Fe-independent, with 73% being downregulated in the FtsH3-depleted mutant .

  • Quantitative proteomics: Label-free proteomics identified proteins whose abundance changes upon FtsH3 depletion, providing insights into post-transcriptional regulation. This approach is particularly valuable for examining the accumulation of transcription factors that regulate nutrient stress responses .

  • Targeted protein analysis: Western blotting with specific antibodies can track changes in key proteins, such as photosystem components or stress response regulators, following FtsH3 depletion .

How does the FtsH1/3 complex contribute to nutrient stress responses in Synechocystis?

The FtsH1/3 complex plays a critical role in acclimation to multiple nutrient stress conditions in Synechocystis, as demonstrated by comprehensive analysis of FtsH-depleted strains:

  • Transcriptional regulation: Depletion of FtsH1/3 leads to drastic reduction in transcriptional responses to multiple nutrient stresses affecting:

    • Iron stress (Fur regulon)

    • Phosphate stress (Pho regulon)

    • Carbon limitation (NdhR regulon)

    • Nitrogen starvation (NtcA regulon)

  • Transcription factor accumulation: FtsH1/3 deficiency results in accumulation of transcription factors that regulate these stress responses, suggesting the protease complex may directly or indirectly control their abundance or activity .

  • Pho regulon regulation: FtsH3 suppression particularly affects the Pho regulon genes, with promoter-proximal pstS1 gene (sll0680) showing approximately 20-fold lower mRNA levels in the FtsH3-depleted mutant compared to wild type .

This evidence indicates that the FtsH1/3 complex sits at a critical regulatory node connecting various nutrient sensing and response pathways, making it essential for environmental adaptation in cyanobacteria.

What is the role of FtsH3 in photosystem maintenance?

FtsH3 plays crucial roles in photosystem quality control and repair:

  • D1 protein turnover: FtsH3-depleted cells show impaired degradation of the D1 protein during high light stress, with the D1 protein band appearing smeared in electrophoretic analysis, indicating oxidative damage .

  • Photosystem II activity: Cells lacking FtsH3 exhibit reduced PSII oxygen-evolving activity, demonstrating its importance for maintaining functional photosystems .

  • Chlorophyll maintenance: FtsH3 depletion leads to decreased cellular chlorophyll a content, suggesting broader effects on photosynthetic apparatus assembly or stability .

These findings indicate that FtsH3 contributes to the critical quality control mechanisms that maintain photosynthetic efficiency, particularly under stress conditions that increase photodamage.

What is the mechanism by which FTSH3 regulates Complex I degradation in plants?

In Arabidopsis thaliana, FTSH3 facilitates Complex I (NADH dehydrogenase) degradation through a specific protein-protein interaction mechanism:

  • Direct interaction with PSST: FTSH3 directly interacts with the Complex I matrix arm domain subunit PSST (20 kDa) located at the interface of the membrane and matrix module. This interaction was confirmed through multiple protein-protein interaction assays .

  • Interaction domains: The interaction involves:

    • The ATPase domain of FTSH3 (mutation P415L disrupts interaction)

    • The N-terminal domain of PSST (mutation S70F disrupts interaction)

  • Function of interaction: This interaction facilitates the disassembly of the CI matrix arm domain for degradation and turnover, particularly in response to oxidative damage .

  • ATPase vs. proteolytic activity: Interestingly, the ATPase function of FTSH3, rather than its proteolytic activity, is required for this interaction. Complementation with proteolytically inactive FTSH3 could still restore Complex I abundance in certain mutant backgrounds .

This mechanism reveals how FTSH3 participates in protein quality control by recognizing specific interaction sites on target complexes and using ATP hydrolysis to drive disassembly, allowing for subsequent degradation of damaged components.

How do FTSH3 complexes differ between plants and cyanobacteria?

There are significant differences in FTSH3 complex formation and function between plants and cyanobacteria:

In Synechocystis (cyanobacteria):

  • Forms hetero-oligomeric complexes with FtsH2 in an alternating FtsH2/FtsH3 hexameric pattern

  • Also forms FtsH1/3 complexes crucial for nutrient stress responses

  • Essential for cell viability

In Arabidopsis (plants):

  • Can form homo-hexamers of FTSH3

  • Can also form hetero-hexamers with FTSH10

  • Only the FTSH3 homo-hexamer appears responsible for Complex I recognition and disassembly

  • FTSH10 does not interact with Complex I components like PSST

This difference in complex formation likely reflects the evolutionary diversification of FtsH proteases to perform specialized functions in different organisms and cellular compartments.

How do FtsH3 functions compare with orthologous proteases in other organisms?

The functions of FtsH3 show remarkable conservation and specialization across different organisms:

  • Human ortholog (AFG3L2): Similar to plant FTSH3, human AFG3L2 can form homo-hexamers or hetero-hexamers with paraplegin (SPG7), but only the AFG3L2 homo-hexamer is responsible for OXPHOS component maturation and degradation .

  • Bacterial FtsH: Like FtsH3, bacterial FtsH exhibits relatively weak unfoldase activity and primarily recognizes substrates when they are misfolded or disassembled from their complexes. This allows bacterial FtsH to regulate membrane-bound proteins based on their folding state or complex association .

  • Plant FTSH3: Functions in disassembly of Complex I components for degradation, particularly recognizing damaged or oxidized subunits. This function appears to be specialized compared to its cyanobacterial counterpart .

These comparisons suggest that while the basic mechanism of FtsH proteases as ATP-dependent quality control factors is conserved across domains of life, specific adaptations have occurred to accommodate the particular needs of different cellular systems and compartments.

What technical challenges must be overcome when working with recombinant FtsH3?

Working with recombinant FtsH3 presents several significant challenges:

How can the substrate specificity of FtsH3 be comprehensively determined?

Determining the complete substrate repertoire of FtsH3 requires multiple complementary approaches:

  • Comparative proteomics: Analyzing protein accumulation patterns in FtsH3-depleted strains versus wild type under various conditions can identify potential substrates. This approach has already revealed effects on multiple stress response regulons .

  • Protein turnover analysis: Pulse-chase experiments with labeled amino acids can determine which proteins show altered degradation rates in the absence of FtsH3.

  • Direct interaction screening: Techniques like protein microarrays, cross-linking mass spectrometry, or proximity labeling could identify proteins that physically interact with FtsH3.

  • Domain mapping: As demonstrated with the PSST interaction, mapping specific interaction domains can reveal how FtsH3 recognizes its substrates. Similar approaches with other putative substrates would provide a more comprehensive understanding of recognition motifs .

  • In vitro degradation assays: Reconstituting FtsH3 complexes with purified potential substrates can directly test degradation activity and specificity under controlled conditions.

What are the experimental considerations when studying FtsH3's role in stress response pathways?

When investigating FtsH3's involvement in stress responses, researchers should consider:

  • Temporal dynamics: The kinetics of FtsH3-mediated regulation may vary across different stress conditions. Time-course experiments are essential to capture these dynamics.

  • Regulatory network effects: FtsH3 depletion affects multiple transcription factors and regulons, creating complex network effects. Systems biology approaches may be needed to fully interpret these interconnected responses .

  • Stress combinations: While individual stresses (Fe, P, C, N) have been studied, natural environments often present multiple simultaneous stresses. Examining FtsH3 function under combined stress conditions would provide more ecologically relevant insights.

  • Post-translational modifications: FtsH3 activity might itself be regulated by modifications like phosphorylation in response to stress signals, adding another layer of complexity to its regulatory functions.

This comprehensive FAQ collection provides researchers with both fundamental knowledge and advanced methodological considerations for studying the complex functions of FtsH3 in cyanobacteria and comparable systems, facilitating deeper investigation into this important ATP-dependent zinc metalloprotease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.