Recombinant Synechocystis sp. ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Structure and Function of ATP Synthase Subunit a (AtpB)

The Fo_oF1_1 ATP synthase in Synechocystis sp. PCC 6803 consists of two main sectors:

  • F1_1: Catalyzes ATP synthesis/hydrolysis via α3_3β3_3γ subunits.

  • Fo_o: A membrane-embedded proton channel composed of subunits a (AtpB), b, and c .

Subunit a (AtpB) is essential for coupling proton movement with rotational mechanics in the Fo_o sector. Mutagenesis studies in Synechocystis have shown that modifications to other subunits (e.g., γ or ϵ) indirectly affect proton translocation efficiency and ATP synthesis rates, highlighting the interdependence of Fo_o and F1_1 components .

Key Features of Recombinant Cyanobacterial AtpB

PropertyDescriptionSource
Host SystemE. coli
TagN-terminal His tag
Amino Acid Range1–239 aa
Molecular FunctionProton channel formation, rotational coupling with F1_1 sector

Functional Insights

  • Proton Translocation: AtpB works with subunit c to create a proton gradient-driven rotation, enabling ATP synthesis .

  • Regulatory Role: Interactions with γ and ϵ subunits modulate ATPase activity to prevent energy waste during dark conditions .

Physiological Impact of Subunit Modifications

  • Deletion of regulatory regions in γ (e.g., β-hairpin) reduces ATP synthesis efficiency by ~30% in Synechocystis .

  • Truncation of the ϵ subunit’s C-terminal domain increases ATP hydrolysis activity, lowering intracellular ATP levels during prolonged darkness .

Comparative Analysis

Strain/MutationATP Synthesis RateATP Hydrolysis ActivitySurvival in Darkness
Wild-Type Synechocystis100%BaselineHigh
γ Δ198–222~70%ElevatedReduced
ϵ ΔC~85%2× baselineModerately Reduced

These findings underscore AtpB’s role in maintaining energy homeostasis, particularly under stress conditions like nutrient limitation or darkness .

Technical Challenges and Future Directions

  • Heterologous Expression: Producing functional AtpB in E. coli (as seen in Synechococcus sp. ) requires optimizing membrane protein folding and stability.

  • Structural Studies: Cryo-EM or X-ray crystallography of recombinant AtpB could clarify its interactions within the Fo_o sector.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we can fulfill specific format requirements. Please indicate your desired format in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; atpI; sll1322; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
atpB
Target Protein Sequence
MQGSLSWLLRFVEGQQLSSLPRQSHRITMLAGLSVLNLFPLAALEVGQQWYWEIGNLKLH GQTFATSWFVILLLVIASLAATRNVQRVPSGIQNLMEYVLEFLRDLARNQLGEKEYRPWL PFIGTLFLFIFVSNWSGALLPWKLIHIPDGAELAAPTNDINTTVALALLTSLAYFYAGLR KKGLGYFANYVQPIPVLLPIKILEDFTKPLSLSFRLFGNILADELVVAVLVLLVPLLVPL PLMALGLFTSAIQALVFATLAGAYIHEAIESEGEEH
Uniprot No.

Target Background

Function
As a key component of the proton channel, ATP synthase subunit a (atpB) plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.