Recombinant Synechocystis sp. ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpF; sll1324; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
atpF
Target Protein Sequence
MLNTLFILAAEAHEAGEGGFGINLDFLEANLFNLAILLGIIIYYAPKTLGKILGDRRQKI ADAIEEAETRQRKSAQILAEEEKKLAQAKAEAARIVQEAGQRAEVAKQEIATQTEADLRR MQEAAAQDLGAEQERVIAELKRRIAEQAVAKAEADLRDRLNEDTQDRLIERSIAQLGGR
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembranous) and the F(0) membrane proton channel, connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel, forming part of the peripheral stalk that links F(1) and F(0).
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is the role of ATP synthase subunit b (atpF) in cyanobacterial energy metabolism?

ATP synthase subunit b (atpF) functions as a critical component of the stator structure in the F₀ portion of ATP synthase. In cyanobacteria like Synechocystis sp., ATP synthase complexes on thylakoid membranes utilize proton gradients generated through either photosynthesis or respiration to produce ATP. The b subunit forms part of the peripheral stalk that prevents rotation of the α₃β₃ hexamer relative to subunit a during catalysis, which is essential for the conversion of the proton-motive force into ATP synthesis . Unlike the mitochondrial ATP synthase, cyanobacterial ATP synthases face unique regulatory challenges because they must function efficiently under both light and dark conditions, necessitating specialized regulatory mechanisms that influence the expression and function of various subunits including atpF.

How does the structure of Synechocystis sp. atpF compare to homologous proteins in other organisms?

While the search results don't specifically detail the Synechocystis sp. atpF structure, comparative analysis suggests that ATP synthase structures maintain considerable conservation across species. For comparison, we can look at the subunit composition across different organisms. In human mitochondrial ATP synthase, the peripheral stalk contains subunit b, which is functionally equivalent to atpF in cyanobacteria. Similarly, in E. coli and yeast, homologous structures exist with some variations in subunit composition and arrangement . The structural conservation reflects the fundamental importance of maintaining the stator function, though species-specific adaptations exist to accommodate different cellular environments.

What experimental evidence supports the current understanding of atpF function?

The current understanding of atpF function builds on decades of structural and functional studies of ATP synthases across species. Experimental approaches including X-ray crystallography, as performed by John Walker's group on bovine mitochondrial complex V, have revealed detailed structural insights into ATP synthase components . For cyanobacterial ATP synthase specifically, techniques such as DNA coimmunoprecipitation followed by mass spectrometry have been employed to identify binding partners and regulatory mechanisms of ATP synthase components . Electrophoretic mobility shift assays (EMSAs) have confirmed protein-DNA interactions for regulatory elements, and these methodologies could be adapted to investigate atpF function and regulation specifically.

What are the most effective expression systems for producing recombinant Synechocystis sp. atpF?

For recombinant expression of cyanobacterial membrane proteins like atpF, E. coli remains a commonly used heterologous host due to its rapid growth, well-established genetic tools, and high protein yields. Similar to the approach used for atpI (another ATP synthase subunit), researchers can use an E. coli expression system with an N-terminal His-tag for easier purification . For optimal expression of atpF:

  • Consider codon optimization for E. coli if expression levels are low

  • Test multiple E. coli strains (BL21(DE3), C41/C43, or Rosetta for rare codons)

  • Optimize induction conditions (temperature, IPTG concentration, induction time)

  • Use specialized vectors containing promoters with tunable expression levels

For membrane proteins like atpF, expression in the native cyanobacterial host might preserve functional properties better, though yields may be lower compared to E. coli systems.

What purification challenges are specific to Synechocystis sp. atpF and how can they be addressed?

Purification of membrane proteins like atpF presents several challenges:

ChallengeSolution StrategyTechnical Considerations
Membrane localizationEfficient membrane solubilizationTest multiple detergents (DDM, LMNG, or digitonin) at various concentrations
Protein stabilityBuffer optimizationInclude stabilizing agents (glycerol 5-50%, specific lipids)
AggregationTemperature controlMaintain samples at 4°C during purification
Low yieldsExpression optimizationTest various tags (His, MBP, GST) and their positions (N or C-terminal)
Functional conformationGentle purification conditionsConsider native-like environments (nanodiscs, amphipols)

Based on protocols used for similar ATP synthase subunits, researchers should employ immobilized metal affinity chromatography (IMAC) for initial purification, followed by size exclusion chromatography to ensure homogeneity . For quality assessment, SDS-PAGE can verify purity (>90% is typically achievable), and circular dichroism can confirm proper folding.

How can researchers effectively study atpF interactions with other ATP synthase subunits?

To investigate protein-protein interactions involving atpF:

  • In vitro approaches:

    • Pull-down assays using tagged recombinant atpF

    • Surface plasmon resonance to determine binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Cross-linking mass spectrometry to identify interaction interfaces

  • In vivo approaches:

    • Bacterial two-hybrid systems

    • Co-immunoprecipitation followed by mass spectrometry

    • FRET or BiFC for visualizing interactions in living cells

  • Structural approaches:

    • Cryo-electron microscopy of the entire ATP synthase complex

    • X-ray crystallography of subcomplexes containing atpF

    • NMR studies of specific interaction domains

When designing these experiments, researchers should consider that ATP synthase assembly occurs in discrete modules, with the stator components (including atpF) assembling separately from the F₁ and c-ring components before final complex formation .

What are the optimal conditions for reconstituting functional atpF into liposomes for activity assays?

Reconstitution of atpF into liposomes requires careful optimization to maintain functionality:

  • Liposome preparation:

    • Use a mixture of phosphatidylcholine and phosphatidic acid (70:30 ratio)

    • Form liposomes by extrusion through polycarbonate filters (100-200 nm pore size)

    • Stabilize membranes with cholesterol (10-20% molar ratio)

  • Protein incorporation:

    • Employ detergent-mediated reconstitution using mild detergents (DDM or Triton X-100)

    • Gradually remove detergent using Bio-Beads or dialysis

    • Maintain protein:lipid ratios between 1:50 and 1:200 (w/w)

  • Functionality verification:

    • Monitor proton translocation using pH-sensitive fluorescent dyes

    • Measure ATP synthesis/hydrolysis activities using enzyme-coupled assays

    • Assess membrane integrity using calcein leakage assays

The incorporation of purified atpF should be performed at 4°C to maintain protein stability, and buffers should mimic physiological conditions of cyanobacterial cells (pH 7.0-7.5 with appropriate salt concentrations).

What strategies can be employed to study the role of atpF in ATP synthase assembly?

To investigate atpF's role in ATP synthase assembly:

  • Genetic approaches:

    • Generate conditional knockout or knockdown strains of atpF

    • Create point mutations in conserved regions to identify critical residues

    • Employ CRISPR-Cas9 for precise genome editing in Synechocystis

  • Biochemical approaches:

    • Use clear native polyacrylamide gel electrophoresis (CN-PAGE) to identify assembly intermediates

    • Compare wild-type vs. mutant cells using BN-PAGE followed by western blotting

    • Perform pulse-chase experiments with labeled amino acids to track assembly kinetics

  • Structural approaches:

    • Employ single-particle cryo-EM to visualize assembly intermediates

    • Use chemical cross-linking to capture transient interaction partners during assembly

Previous research on ATP synthase assembly suggests that the peripheral stalk (including atpF) assembles separately from the F₁ and c-ring modules before final complex formation . Researchers should design experiments that can detect these assembly intermediates under different physiological conditions.

How can researchers distinguish between direct and indirect effects when studying atpF mutations?

Distinguishing direct from indirect effects requires multiple complementary approaches:

  • Complementation studies:

    • Reintroduce wild-type atpF in mutant strains to confirm phenotype rescue

    • Create chimeric proteins with domains from related species to identify functional regions

  • Biochemical verification:

    • Perform in vitro reconstitution with purified components to demonstrate direct effects

    • Use site-directed mutagenesis to identify critical residues

  • Secondary effect analysis:

    • Monitor expression levels of other ATP synthase subunits

    • Assess cellular energetics (ATP/ADP ratio, membrane potential) to quantify physiological impacts

    • Examine compensatory mechanisms that may mask primary defects

  • Time-resolved studies:

    • Use inducible expression systems to track immediate vs. delayed effects

    • Implement metabolic flux analysis to identify network-wide perturbations

When interpreting data from atpF mutations, researchers should consider that ATP synthase defects can trigger retrograde signaling pathways that alter gene expression patterns, potentially confounding direct observations .

What controls should be included when studying atpF expression under different environmental conditions?

Comprehensive controls for atpF expression studies include:

Research on other ATP synthase components has shown dramatic differences in expression and stability under different conditions. For example, atpT transcript stability varies significantly (half-life of 1.6 minutes in light versus 33 minutes in darkness) , suggesting that careful time-resolved sampling is critical for accurate expression analysis.

How does atpF contribute to the regulation of ATP synthase activity under fluctuating light conditions?

In cyanobacteria like Synechocystis sp., rapidly fluctuating light conditions present a unique regulatory challenge for ATP synthase. While not explicitly detailed for atpF in the search results, we can draw parallels with the regulatory mechanisms observed for other ATP synthase components:

  • Structural stabilization:

    • As part of the peripheral stalk, atpF likely provides critical structural stability under varying energetic conditions

    • Mutations in stator components could lead to decreased complex stability during light-dark transitions

  • Regulatory interactions:

    • AtpF may interact with condition-specific regulatory factors similar to AtpΘ, which prevents wasteful ATP hydrolysis in darkness

    • Potential phosphorylation sites on atpF could allow rapid activity modulation

  • Expression regulation:

    • Like atpT, atpF expression and stability may be regulated in response to changing light conditions

    • Transcription factors similar to RpaB, cyAbrB1, and cyAbrB2 might regulate atpF expression

What are the methodological considerations for studying the impact of atpF modifications on proton translocation?

Studying proton translocation requires specialized techniques and careful experimental design:

  • Inverted membrane vesicle preparation:

    • Isolate thylakoid membranes from Synechocystis

    • Create inside-out vesicles through sonication or French press treatment

    • Verify orientation using specific markers

  • Proton translocation measurement approaches:

    • Fluorescent probes (ACMA, pyranine) to monitor pH changes

    • Radioisotope (³H⁺) flux measurements for quantitative analysis

    • Patch-clamp electrophysiology for direct current measurement

  • Activity coupling analysis:

    • Simultaneously measure ATP synthesis/hydrolysis and proton translocation

    • Calculate H⁺/ATP ratios under different conditions

    • Assess effects of specific inhibitors on coupled activities

  • Reconstitution systems:

    • Purify individual components and reconstitute in defined lipid environments

    • Systematically vary the lipid composition to assess environmental effects

    • Compare native membranes vs. reconstituted systems

The experimental setup should include provisions to carefully control temperature, light conditions, and redox status, as these factors significantly impact ATP synthase activity in cyanobacteria. Researchers should be particularly mindful of the bidirectional capability of ATP synthase (synthesis vs. hydrolysis) when interpreting results .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.