Recombinant Synechocystis sp. CemA-like protein sll1685 (sll1685)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
sll1685; CemA-like protein sll1685
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
sll1685
Target Protein Sequence
MLPDKKLGSPNHRFHHWLVRQAIAALDNAQVSAQAIESIEKTYFDGGKIAPDSQRGVNTY NYFKSTLERELLKIKFNLARFNATNLLNNSEDFQITEAEIIVKLDAIEKIIAKYRFSEDL VEVDSQSSAEINNISPKRSNFFNIQRDLSAQDEQKILQNLRNLRLQRRIATRFLIVLIFI PLTVQILTKNLVFAPLVQHFRVDIVAWEKIHYQEETIEHYFEEFARYKETLEIKQLLSEN QPLNQEKIHQELKKKAEELIRQAATNSQQGIVNLLADIAGLVAFVVLIIVFRGKSIITQQ YLSQSFLALNDITKVFIFILLTDMFVGFHSAHGWEVVLENLTSHFGLPENRHAVYIFIAT VPVFLDSLFKLLIFNYFTRQSPTSVAILEKMQQ
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion. It indirectly promotes efficient inorganic carbon uptake.
Database Links
Protein Families
Cema family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the standard storage conditions for recombinant sll1685 protein?

The recombinant sll1685 protein should be stored according to specific guidelines to maintain its stability and biological activity. Upon receipt, the protein should be stored at -20°C/-80°C, with aliquoting being necessary for multiple use. For working aliquots, storage at 4°C for up to one week is recommended. It is important to avoid repeated freeze-thaw cycles as this can significantly compromise protein integrity .

For long-term storage, the protein can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (final concentration) before aliquoting and storing at -20°C/-80°C. The standard storage buffer typically consists of a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

What expression systems are commonly used for producing recombinant sll1685?

E. coli is the most commonly used expression system for the production of recombinant sll1685 protein. This heterologous expression system has been optimized for the production of the full-length (1-393 amino acids) protein with various fusion tags, particularly the N-terminal His-tag which facilitates purification .

When expressing recombinant proteins in prokaryotic systems like E. coli, several factors need to be considered:

  • Selection of appropriate E. coli strain (BL21, Rosetta, etc.)

  • Optimization of induction conditions (IPTG concentration, temperature, duration)

  • Codon optimization for the target gene

  • Selection of appropriate vector with compatible promoter and fusion tags

The expression system selection should be based on the specific research requirements, including the need for post-translational modifications, protein solubility, and downstream applications .

How can I optimize the expression of recombinant sll1685 using Design of Experiments (DoE)?

Optimization of recombinant sll1685 expression can be achieved using Design of Experiments (DoE), a statistical approach that allows for systematic investigation of multiple factors simultaneously. The typical DoE workflow for optimizing recombinant protein production involves:

  • Define objectives and select factors, levels, and responses

  • Identify process variables and set their levels (high, low, and sometimes mid-point)

  • Select an appropriate experimental design

  • Build a mathematical model

  • Analyze and visualize response data

  • Perform further optimization with selected influential factors

For recombinant sll1685 expression, a two-level factorial design could be implemented to investigate 9 key factors:

FactorLow Level (-1)High Level (+1)
Temperature25°C37°C
Induction time4 hours16 hours
IPTG concentration0.1 mM1.0 mM
Media compositionMinimalRich
OD600 at induction0.61.2
Post-induction temperature16°C30°C
Shaking speed150 rpm250 rpm
pH6.57.5
Antibiotic concentration50 μg/mL100 μg/mL

After identifying the most influential factors through a screening design like Plackett-Burman Design (PBD), further optimization can be conducted using Response Surface Methodology (RSM) approaches such as Central Composite Design (CCD) or Box-Behnken Design (BBD). These approaches have been shown to increase recombinant protein yields by 3-5 fold in similar systems .

What analytical techniques are most appropriate for characterizing recombinant sll1685?

Comprehensive characterization of recombinant sll1685 requires multiple analytical techniques:

  • Primary structure analysis:

    • Mass spectrometry (MS) for exact molecular weight determination

    • N-terminal sequencing for confirmation of the starting amino acid

    • Peptide mapping using LC-MS/MS after enzymatic digestion

  • Secondary and tertiary structure analysis:

    • Circular dichroism (CD) spectroscopy for secondary structure content

    • Fourier-transform infrared spectroscopy (FTIR)

    • Nuclear magnetic resonance (NMR) for detailed structural information

    • X-ray crystallography for high-resolution 3D structure

  • Purity assessment:

    • SDS-PAGE with Coomassie or silver staining (>90% purity is typically expected)

    • Size-exclusion chromatography (SEC)

    • Reversed-phase HPLC

  • Functional characterization:

    • Activity assays specific to CemA-like proteins

    • Binding assays to identify interaction partners

    • Stability assessments under various conditions

Analytical MethodParameter MeasuredResult
SDS-PAGEPurity>90%
Mass SpectrometryMolecular Weight~44 kDa (with His-tag)
CD SpectroscopySecondary Structure% α-helix, % β-sheet
SEC-MALSOligomeric StateMonomer/Dimer ratio

The combination of these techniques provides a comprehensive profile of the recombinant protein, ensuring its identity, purity, and structural integrity before proceeding with functional studies .

How does sll1685 respond to iron deprivation conditions in Synechocystis sp.?

Based on gene expression data, sll1685 shows differential expression patterns under iron deprivation conditions in Synechocystis sp. Analysis of transcriptomic data reveals complex expression patterns in response to iron limitation:

Gene IDGene NameExpression Value (Log2 Fold Change)
sll1685CemA-like proteinVaries by condition and time point

The expression pattern suggests that sll1685 may be involved in cellular adaptation to iron limitation. To further investigate this response, researchers should consider:

  • Time-course experiments: Monitor expression changes at multiple time points after initiating iron deprivation

  • Comparative proteomics: Compare protein levels with transcript levels to identify post-transcriptional regulation

  • Knockout/complementation studies: Create sll1685 mutants to assess phenotypic changes under iron limitation

  • Protein interaction studies: Identify potential interaction partners that may form functional complexes during stress response

The analysis of contradictory expression data across different studies requires careful consideration of experimental conditions, including the severity and duration of iron limitation, light conditions, and other environmental factors .

What is the recommended methodology for studying protein-protein interactions of sll1685?

To investigate protein-protein interactions involving recombinant sll1685, multiple complementary approaches should be employed:

  • In vitro approaches:

    • Pull-down assays using His-tagged sll1685 as bait

    • Surface plasmon resonance (SPR) for real-time binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Analytical ultracentrifugation to determine complex stoichiometry

  • In vivo approaches:

    • Bacterial two-hybrid system adapted for cyanobacterial proteins

    • Co-immunoprecipitation from Synechocystis lysates

    • Proximity labeling techniques such as BioID or APEX2

    • Fluorescence resonance energy transfer (FRET) for living cell studies

  • Computational approaches:

    • Protein-protein interaction prediction algorithms

    • Molecular docking simulations

    • Sequence co-evolution analysis

A systematic approach would first identify potential interaction partners using high-throughput methods, followed by validation with targeted experiments. For instance, a pull-down assay using His-tagged sll1685 could identify candidate interactors that would then be confirmed using orthogonal methods such as SPR or ITC.

When documenting interaction studies, present data in well-organized tables:

Interaction PartnerDetection MethodBinding Affinity (Kd)Interaction Domain
Protein XPull-down / MSN/AN-terminal domain
Protein YSPR5.3 μMC-terminal domain
Protein ZITC2.1 μMMiddle domain

This multi-method approach provides robust evidence for genuine protein-protein interactions and helps characterize their functional significance .

How can I design an experiment to determine the subcellular localization of sll1685?

Determining the subcellular localization of sll1685 requires a multi-faceted experimental approach:

  • Computational prediction:

    • Use algorithms specific for bacterial proteins to predict transmembrane domains, signal peptides, and localization signals

    • Tools such as TMHMM, SignalP, and PSORT-B can provide initial predictions

  • Fluorescent protein fusion:

    • Generate C- and N-terminal GFP fusions of sll1685

    • Express in Synechocystis under native or inducible promoters

    • Visualize using confocal microscopy with appropriate markers for different cellular compartments

  • Subcellular fractionation:

    • Isolate different cellular fractions (cytoplasmic, membrane, thylakoid, etc.)

    • Detect sll1685 using Western blotting with specific antibodies

    • Include controls for each fraction (known proteins with established localizations)

  • Immunogold electron microscopy:

    • Use antibodies against sll1685 with gold-conjugated secondary antibodies

    • Visualize precise localization at nanometer resolution

The experimental design should include appropriate controls and validation steps. For example, when using GFP fusions, it is important to verify that the fusion protein retains functionality and that the GFP tag does not interfere with localization signals.

Results can be presented in a comprehensive table format:

MethodPredicted/Observed LocalizationConfidence LevelComments
TMHMM prediction5 transmembrane domainsHighHydrophobic regions at positions X-Y
GFP fusion (C-terminal)Plasma membraneHighCo-localization with plasma membrane marker
GFP fusion (N-terminal)Disrupted localizationMediumPotential N-terminal signal sequence
Subcellular fractionationEnriched in membrane fractionHighDetected by Western blot
Immunogold EMPlasma membraneVery highPrecise localization at cell periphery

How can I interpret contradictory data when studying sll1685 function?

When faced with contradictory data regarding sll1685 function, a systematic approach to analysis and interpretation is essential:

  • Examine experimental conditions:

    • Compare expression systems (E. coli strains, growth conditions)

    • Assess protein preparation methods (purification tags, buffer compositions)

    • Review experimental parameters (temperature, pH, salt concentration)

  • Evaluate methodological differences:

    • Identify variations in assay formats

    • Compare detection methods and their sensitivities

    • Consider the impact of protein modifications or tag positions

  • Conduct statistical analysis:

    • Perform meta-analysis of multiple datasets when available

    • Apply appropriate statistical tests to determine significance

    • Use power analysis to ensure adequate sample sizes

  • Design reconciliation experiments:

    • Create experiments specifically designed to address the contradictions

    • Include side-by-side comparisons of methods

    • Introduce controlled variables to isolate sources of discrepancy

When documenting contradictory findings, use a structured approach to present the conflicting data:

StudyKey FindingExperimental ConditionsPotential Explanation for Discrepancy
Study Asll1685 upregulated during iron deprivation3-day iron starvation, high lightExtended response to severe stress
Study Bsll1685 downregulated during iron deprivation12-hour iron limitation, standard lightInitial stress response differs
Current studyBiphasic responseTime course over 7 daysCaptures both early and late responses

This approach not only acknowledges contradictions but transforms them into opportunities for deeper understanding of the protein's function under different conditions or contexts .

What approaches should I use to study the structure-function relationship of sll1685?

Investigating the structure-function relationship of sll1685 requires an integrated approach combining structural biology, molecular biology, and biochemical techniques:

  • Structural characterization:

    • X-ray crystallography or cryo-EM for high-resolution structure

    • NMR spectroscopy for dynamic regions and ligand binding

    • Homology modeling based on related proteins if experimental structures are unavailable

  • Domain mapping:

    • Generate truncation constructs to isolate functional domains

    • Express and purify individual domains for functional testing

    • Create chimeric proteins with domains from related CemA-like proteins

  • Site-directed mutagenesis:

    • Identify conserved residues through sequence alignment

    • Design mutations of key residues (conservative and non-conservative)

    • Generate comprehensive alanine scanning library for systematic analysis

  • Functional assays:

    • Develop quantitative assays for specific functions

    • Test wild-type and mutant proteins under identical conditions

    • Correlate structural features with functional outcomes

The mutational analysis data can be presented in a comprehensive table format:

MutationStructural LocationFunctional EffectConservationInterpretation
K15AN-terminal domain85% activityHighly conservedNot essential but contributes
D120ACentral domain<5% activityInvariantCritical catalytic residue
R250AC-terminal domain50% activityVariableModulatory role
Triple mutant (KDR→AAA)Multiple domainsNo activityMixedSynergistic effect

This systematic approach allows for mapping of functional sites and establishing the molecular basis for sll1685 activity, providing insights into both the specific protein and the broader CemA-like protein family .

What are the best practices for optimizing purification of recombinant sll1685?

Optimizing the purification of recombinant His-tagged sll1685 requires careful consideration of multiple factors:

  • Lysis buffer optimization:

    • Test different buffer compositions (Tris, phosphate, HEPES)

    • Optimize pH range (typically 7.5-8.5 for His-tagged proteins)

    • Evaluate detergent types and concentrations if membrane-associated

    • Include appropriate protease inhibitors

  • Immobilized metal affinity chromatography (IMAC) conditions:

    • Compare Ni-NTA, Co-NTA, and other metal resins

    • Optimize imidazole concentrations for binding, washing, and elution

    • Evaluate flow rates and contact times

    • Consider on-column refolding if protein forms inclusion bodies

  • Secondary purification steps:

    • Size exclusion chromatography for final polishing

    • Ion exchange chromatography to remove contaminants

    • Affinity tag removal and subsequent separation

  • Quality assessment:

    • SDS-PAGE analysis for purity (>90% is typically achievable)

    • Western blotting for identity confirmation

    • Mass spectrometry for intact mass verification

    • Dynamic light scattering for homogeneity

A sample purification optimization table:

ParameterCondition 1Condition 2Condition 3Optimal
Lysis bufferPBS, pH 7.4Tris 50mM, pH 8.0HEPES 50mM, pH 8.0Tris 50mM, pH 8.0
DetergentNone0.1% Triton X-1001% NP-400.1% Triton X-100
IMAC resinNi-NTACo-NTATALONNi-NTA
Wash imidazole10 mM20 mM30 mM20 mM
Elution imidazole250 mM300 mM500 mM300 mM
Final yield3 mg/L5 mg/L2 mg/L5 mg/L
Purity85%92%95%>90%

The purified protein should be rapidly aliquoted and stored with 50% glycerol at -20°C or -80°C to avoid repeated freeze-thaw cycles, which can significantly affect protein stability and activity .

How can I develop a quantitative assay to measure sll1685 activity?

Developing a quantitative assay for sll1685 activity requires first understanding its putative function as a CemA-like protein. Based on the available information, several approaches can be considered:

  • Membrane transport/ion flux assays:

    • Reconstitute purified sll1685 into liposomes

    • Measure ion flux using fluorescent dyes or electrochemical methods

    • Monitor pH changes associated with transport activity

    • Use radio-labeled substrates to track movement across membranes

  • Binding assays:

    • Microscale thermophoresis (MST) to measure binding to potential ligands

    • Surface plasmon resonance (SPR) for real-time binding kinetics

    • Fluorescence anisotropy for interaction with small molecules

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Enzyme-coupled assays (if enzymatic activity is suspected):

    • Spectrophotometric assays linked to NAD(P)H production/consumption

    • Coupled enzyme systems that amplify signal detection

    • Colorimetric assays for potential products

  • In vivo functional complementation:

    • Generate knockout strains of sll1685 in Synechocystis

    • Complement with wild-type and mutant versions

    • Measure restoration of phenotype quantitatively

For assay development, a systematic optimization approach should be documented:

Assay ParameterOptimization RangeOptimal ConditionImpact on Assay
Buffer compositionHEPES, Tris, PhosphateHEPES 50mMMinimal background
pH6.5-8.57.5Maximum signal:noise
Temperature25-40°C30°CStable baseline
Substrate concentration1-100 μM25 μMBelow saturation
Detection methodAbsorbance, fluorescenceFluorescence10-fold sensitivity increase
Linear range0.1-10 μM0.5-5 μMR² > 0.99
Z-factor0.5-0.80.7Excellent assay quality

The final assay should be validated with positive and negative controls, dose-response curves, and statistical analysis to ensure reproducibility and reliability for characterizing both wild-type sll1685 and any mutant variants .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.