Recombinant Synechocystis sp. Cytochrome b6-f complex iron-sulfur subunit 1 (petC1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petC1; slr1185; Cytochrome b6-f complex iron-sulfur subunit 1; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 1; ISP 1; RISP 1; Rieske iron-sulfur protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
petC1
Target Protein Sequence
MDNTQAIAPPSYSRRQLLNFLAGTTVAVTASAGAYAMGKFFVPPAEKGGAGGGIIAKDVL GNPIPASQILAEAPGTRALVAGLAGDPTYLIVKEDGSLDSIGIVDSCTHLGCTFPWNGND QEFQCPCHGSRYHPDGSVARGPAPLPLKIVQVAVVDDQIFISPWTDLDPRTGEKPWWV
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is PetC1 and what role does it play in Synechocystis sp. PCC 6803?

PetC1 (Sll1316) serves as the major Rieske iron-sulfur protein in the Cytochrome b6f complex of Synechocystis sp. PCC 6803. It functions as an essential component of the photosynthetic electron transport chain, facilitating electron transfer between photosystem II and photosystem I. As a Rieske protein family member in Synechocystis, PetC1 contains an iron-sulfur cluster that participates in redox reactions critical for photosynthesis . The protein has been characterized structurally, with a known crystal structure that has informed various functional studies and biotechnological applications .

How does PetC1 differ from other Rieske proteins in Synechocystis sp. PCC 6803?

PetC1 is specifically identified as the major Rieske protein in Synechocystis sp. PCC 6803, indicating its predominant role in the Cytochrome b6f complex compared to other Rieske family members . While Synechocystis contains multiple petC genes encoding ferredoxin-like proteins, PetC1 has unique structural features including an uncleaved signal peptide within its transmembrane domain that directs its localization to the thylakoid membrane . This distinct membrane targeting capability makes PetC1 particularly valuable for biotechnological applications involving thylakoid membrane localization of recombinant proteins .

What is the membrane topology and localization pattern of PetC1?

PetC1 exhibits a defined membrane topology with a transmembrane domain that anchors the protein to the thylakoid membrane. The protein is transported via the twin arginine translocation (Tat) machinery, which translocates fully folded proteins across membranes . Unlike many other Tat substrates, PetC1 possesses an uncleaved signal peptide that remains as part of the mature protein's transmembrane domain . When visualized through fusion proteins like PetC1-GFP, the protein localizes specifically to the thylakoid membrane without assembling into the native Cytochrome b6f complex, suggesting it maintains independent membrane targeting capabilities even when modified .

How can PetC1 be used to improve heterologous protein expression in cyanobacteria?

PetC1 demonstrates significant utility for enhancing heterologous protein expression in cyanobacteria through fusion strategies. Research shows that specific elements of PetC1, particularly its signal peptide and transmembrane domain, can be fused to heterologous proteins to improve their thylakoid membrane targeting and stability . In studies with cytochrome P450 enzymes like CYP79A1, fusion with PetC1 elements resulted in up to 21 times higher protein accumulation compared to unmodified enzymes . This approach is particularly valuable for expression of membrane-bound enzymes that require specific subcellular localization to function effectively. The experimental design typically involves creating fusion constructs with varying arrangements of PetC1 elements (full-length protein, transmembrane domain only, or signal peptide) to optimize targeting efficiency for the specific heterologous protein .

What design parameters should be considered when creating PetC1 fusion proteins?

When designing PetC1 fusion proteins, several critical parameters require careful consideration:

  • Transmembrane domain configuration: Whether to include the native transmembrane domain of the target protein, replace it with PetC1's transmembrane domain, or create constructs with multiple transmembrane segments

  • Linker selection: The inclusion and type of linker sequences between PetC1 elements and the target protein significantly impacts membrane orientation and enzyme activity

  • Fusion position: Whether N-terminal or C-terminal fusions are more effective for specific applications

  • Signal peptide retention: Decision to maintain the uncleaved signal peptide from PetC1 for Tat-dependent translocation

A systematic comparison of different PetC1 fusion variants with CYP79A1 demonstrated that fusion designs incorporating a second transmembrane domain (via PetC1 signal peptide) resulted in the highest protein accumulation levels, while exchanging the native transmembrane domain with that of PetC1 enhanced specific enzyme activity without significantly increasing protein levels .

How does the fusion of PetC1 with CYP79A1 affect enzyme activity compared to unmodified CYP79A1?

The fusion of PetC1 elements with CYP79A1 significantly impacts enzyme activity in multiple ways:

PetC1 Fusion VariantRelative Protein LevelChlorophyll-Normalized Oxime LevelEnzyme-Specific Activity
Unmodified CYP79A11.01.01.0
ΔTM (no transmembrane domain)<0.1*0.9N/A
PetC-TM (PetC1 TM replacement)1.28.05.0
2× TM (added PetC1 signal peptide)12.018.01.5
PetC fusion (full PetC1)<0.1*3.0N/A
2× TM linker (2× TM with GGGS linker)21.08.00.3

*Protein levels below detection limit but active based on oxime production

How does the Tat-dependent translocation of PetC1 influence its folding and stability compared to Sec-dependent proteins?

The Tat-dependent translocation pathway used by PetC1 represents a specialized protein transport mechanism in cyanobacteria that fundamentally differs from the Sec pathway in that it translocates fully folded proteins across membranes. This distinctive feature provides several advantages for PetC1 and proteins fused to its elements. The Tat machinery incorporates a quality control or "proof-reading" function that ensures only properly folded proteins with correctly incorporated cofactors are translocated . For complex redox enzymes like P450 cytochromes fused to PetC1 elements, this facilitates the accumulation of active holoenzymes with properly incorporated heme cofactors in the thylakoid membrane .

Experimental evidence suggests that this pathway contributes to the enhanced stability observed in PetC1 fusion proteins compared to those targeted through other mechanisms. The targeted selection of Tat substrates like PetC1 for fusion partners represents a sophisticated strategy that exploits the native quality control mechanisms of the cyanobacterial cell to improve heterologous protein expression .

What is the relationship between PetC1 expression and diurnal regulation in Synechocystis sp. PCC 6803?

Transcriptomic studies have revealed that petC gene expression in Synechocystis sp. PCC 6803 exhibits diurnal regulation patterns, suggesting temporal control of Cytochrome b6f complex components in response to light cycles . While specific diurnal regulation patterns for PetC1 are not fully characterized in the available search results, related components of the electron transport chain show distinct expression profiles throughout light/dark cycles. For example, transcripts for plastocyanin (petE) and cytochrome c553 (petJ)—both electron carriers downstream of the Cytochrome b6f complex—are significantly upregulated at the L3 phase of the light period and downregulated afterward .

This temporal coordination likely extends to PetC1 as a critical component of the photosynthetic electron transport chain, suggesting that researchers should consider timing of sampling and expression when designing experiments involving recombinant PetC1 systems. Comprehensive investigation of PetC1's diurnal expression pattern would provide valuable insights for optimizing recombinant protein production strategies in Synechocystis .

What is the impact of PetC1 overexpression on native Cytochrome b6f complex assembly?

Experimental evidence indicates that PetC1 overexpression does not significantly disrupt native Cytochrome b6f complex assembly in Synechocystis. Studies using PetC1-GFP fusion demonstrated that the fusion protein localizes to the thylakoid membrane but does not incorporate into the Cytochrome b6f complex . This observation is supported by growth data from strains expressing various PetC1 fusion constructs, which generally exhibit growth rates comparable to control strains .

The exception occurs with specific fusion designs (PetC-TM and 2× TM variants) that showed somewhat reduced growth and altered pigment content, suggesting potential minor interference with photosynthetic processes under certain conditions . The relative independence of recombinant PetC1 from native complex assembly represents a significant advantage for biotechnological applications, as it reduces the risk of disrupting essential photosynthetic functions when using PetC1 as a fusion partner .

What are the optimal conditions for expressing recombinant PetC1 fusion proteins in Synechocystis?

Based on experimental protocols from successful studies, the optimal conditions for expressing recombinant PetC1 fusion proteins in Synechocystis sp. PCC 6803 typically include:

  • Growth medium: BG-11 medium supplemented with 5 mM HEPES (pH a 7.5) provides appropriate nutrient conditions .

  • Temperature: Maintenance at 30°C supports optimal growth while allowing proper expression of recombinant proteins .

  • Light conditions: A linear gradient from 30 to 100 μmol of photons m^-2 s^-1 over 72 hours, followed by constant illumination at 100 μmol of photons m^-2 s^-1 supports photosynthetic growth while minimizing light stress .

  • Carbon supplementation: Bubbling with 3% (v/v) CO₂-supplemented air enhances photosynthetic performance and growth .

  • Expression induction: IPTG induction (0.1 mM) after 24 hours of growth activates expression from the trc promoter commonly used in PetC1 fusion constructs .

  • Antibiotic selection: For maintaining plasmids, supplementation with 50 μg/ml spectinomycin ensures stable inheritance of expression vectors .

This cultivation approach allows for robust expression while maintaining photosynthetic capacity, which is essential when working with components of the photosynthetic machinery like PetC1 .

What techniques are most effective for analyzing PetC1 localization and integration in thylakoid membranes?

Several complementary analytical techniques have proven effective for characterizing PetC1 localization and membrane integration:

  • Immunoblot analysis: Western blotting using specific antibodies against either PetC1 or the fused protein of interest provides quantitative assessment of protein accumulation in different membrane fractions .

  • Membrane fractionation: Differential centrifugation techniques separating thylakoid membranes from plasma membranes and soluble fractions help confirm specific localization to thylakoid membranes .

  • Fluorescent protein fusion analysis: Fusion with fluorescent proteins like GFP allows visualization of membrane localization through confocal microscopy, as demonstrated with PetC1-GFP constructs .

  • Prediction tools and validation: Computational tools like THMM2.0 for predicting transmembrane domains and membrane topology provide initial structural insights that can be experimentally validated .

  • Functional assays: For PetC1 fusions with enzymes like CYP79A1, measurement of enzymatic products (e.g., oximes) by LC-MS correlates functional activity with proper membrane integration .

These methodologies collectively provide robust characterization of PetC1 fusion localization, stability, and functional integration into thylakoid membranes .

How can researchers optimize fusion designs for specific thylakoid targeting applications?

Optimizing PetC1 fusion designs requires systematic exploration of multiple parameters based on protein engineering principles and empirical testing:

  • Structural element screening: Testing multiple fusion variants with different PetC1 elements (full protein, transmembrane domain only, signal peptide with native protein TM) provides critical comparative data to identify optimal designs .

  • Linker engineering: Implementing flexible linkers (such as GGGS repeats) between PetC1 elements and the target protein can significantly alter membrane orientation and enzyme activity, requiring empirical optimization .

  • Membrane topology prediction and validation: Using computational tools like THMM2.0 to predict membrane topology of fusion variants, followed by experimental validation through activity assays or reporter fusions .

  • Activity-stability balance assessment: Quantifying both protein accumulation levels and specific enzymatic activity helps identify designs that balance stability improvements with maintained or enhanced catalytic efficiency .

  • Growth impact evaluation: Monitoring strain growth characteristics ensures the fusion design doesn't substantially impair photosynthetic capacity or cellular viability .

The optimal approach combines these strategies in an iterative design-build-test cycle, as demonstrated in the systematic comparison of six CYP79A1 variants with different PetC1 fusion elements .

Why might some PetC1 fusion proteins show high activity despite low detection levels in immunoblot analysis?

Some PetC1 fusion proteins, particularly the ΔTM (transmembrane domain deleted) and full PetC1 fusion variants, demonstrated significant enzymatic activity despite protein levels below the detection limit in immunoblot analysis . This apparent contradiction can be explained by several possible mechanisms:

  • Enhanced specific activity: The fusion or modification may dramatically increase the catalytic efficiency of each enzyme molecule, allowing fewer protein molecules to produce detectable product levels .

  • Detection limitations: The antibody epitope might be partially masked in certain fusion configurations, reducing detection efficiency while the protein remains present and active .

  • Membrane microdomain localization: Improved localization to specific thylakoid membrane microdomains may enhance access to photosynthetic electron transport components, significantly boosting activity per enzyme molecule .

  • Protein turnover dynamics: Some fusion variants might have rapid turnover rates but maintain a small, highly active population of enzyme molecules at steady state .

When encountering this phenomenon, researchers should implement complementary detection methods such as activity assays with variable substrate concentrations, alternative antibody epitopes, or fusion with detectable tags at different positions to fully characterize the actual protein abundance and distribution .

What factors should be considered when PetC1 fusion variants show reduced growth compared to control strains?

Certain PetC1 fusion variants, specifically the PetC-TM (3) and 2× TM (4) strains, demonstrated reduced growth rates and lower final biomass compared to control strains . When encountering growth deficits with PetC1 fusion constructs, researchers should systematically investigate:

  • Energetic burden: High-level expression of membrane proteins may impose significant energetic costs, diverting resources from growth processes .

  • Photosynthetic apparatus interference: Some fusion designs might partially disrupt photosynthetic electron transport or thylakoid membrane organization, as suggested by altered pigment content observed in affected strains .

  • Redox imbalance: Integration of active redox enzymes like cytochromes may create electron sinks that compete with native photosynthetic processes, particularly if the fusion protein diverts electrons from key photosynthetic pathways .

  • Protein aggregation effects: Membrane protein overexpression may lead to aggregation or misfolding stress that triggers growth-limiting stress responses .

  • Regulatory adjustments: Implementing tunable or weaker promoters, optimizing culture conditions (light intensity, carbon availability), or creating fusion variants with reduced expression levels may help balance protein production with acceptable growth characteristics .

These considerations are essential for developing PetC1 fusion systems that remain viable for extended cultivation periods required in many biotechnological applications .

How might combining PetC1 targeting with other electron transport optimization strategies enhance light-driven biocatalysis?

Future research could significantly advance light-driven biocatalysis by integrating PetC1-based targeting with complementary approaches for optimizing electron transport in cyanobacterial systems:

  • Direct electron donor fusion: Combining PetC1 targeting with direct fusion to dedicated electron donors could create highly efficient electron channeling systems for heterologous redox enzymes .

  • Competing pathway elimination: Systematic elimination of competing electron sinks in the cyanobacterial cell would complement PetC1 targeting by ensuring maximal electron flow to the target enzyme .

  • Alternative electron carrier evaluation: Testing different electron carriers in conjunction with PetC1-targeted enzymes could identify optimal combinations for specific catalytic applications .

  • Energy metabolism balancing: Integrating PetC1 targeting with approaches that balance cellular energy metabolism (sources and sinks) could potentially improve not only heterologous enzyme performance but also enhance the photosynthetic capacity of the host organism .

These integrated strategies represent promising directions for developing next-generation whole-cell cyanobacterial biocatalytic systems driven by photosynthetic electron transport .

What potential exists for applying PetC1 fusion strategies to multi-enzyme pathway engineering in cyanobacteria?

PetC1 fusion approaches show considerable potential for multi-enzyme pathway engineering in cyanobacteria by enabling coordinated thylakoid membrane localization of multiple pathway components:

  • Spatial organization optimization: Strategic localization of sequential pathway enzymes to thylakoid membranes could facilitate substrate channeling and enhance pathway flux .

  • Electron transport integration: For pathways requiring reducing power, PetC1-mediated thylakoid targeting could position multiple redox enzymes to efficiently access photosynthetic electron transport components .

  • Modular fusion designs: Creating standardized PetC1 fusion modules optimized for different enzyme classes would accelerate pathway engineering efforts .

  • Co-localization strategies: Combining different thylakoid targeting elements (including PetC1 variants) could enable sophisticated spatial organization of pathway components .

Preliminary work with plant natural product pathways, like the CYP79A1-catalyzed conversion of tyrosine to p-hydroxyphenylacetaldoxime, demonstrates the feasibility of this approach for complex biochemical transformations in cyanobacterial hosts .

How does PetC1 compare to other Rieske proteins in cyanobacterial electron transport chains?

PetC1 represents one of multiple petC genes encoding Rieske family proteins in Synechocystis sp. PCC 6803, with distinct functional and regulatory characteristics:

  • Functional predominance: PetC1 is specifically identified as the major Rieske protein in the Cytochrome b6f complex, indicating its primary role in photosynthetic electron transport compared to other Rieske proteins .

  • Expression patterns: While PetC1-specific diurnal expression data is limited in the provided search results, related electron transport components show distinct temporal regulation patterns, suggesting coordinated expression of these functionally connected proteins .

  • Structural features: PetC1's uncleaved signal peptide represents a distinctive structural feature that contributes to its thylakoid membrane targeting capabilities, which may differ from other Rieske family members .

  • Biotechnological utility: PetC1's experimentally demonstrated capability to direct heterologous proteins to thylakoid membranes makes it particularly valuable for biotechnological applications compared to other Rieske proteins .

This comparative understanding helps researchers select appropriate components for specific applications in photosynthetic research and biotechnology .

What are the key differences in using PetC1 elements versus other thylakoid targeting approaches in cyanobacteria?

PetC1-based targeting offers distinct advantages and characteristics compared to alternative thylakoid targeting approaches in cyanobacteria:

  • Tat-dependent translocation: Unlike Sec-dependent approaches, PetC1 utilizes the Tat pathway that translocates folded proteins with properly incorporated cofactors, potentially enhancing the functional yield of complex heterologous enzymes .

  • Uncleaved signal sequence: PetC1's uncleaved signal peptide within the transmembrane domain differs from many other targeting sequences that are cleaved after translocation, potentially providing more stable membrane anchoring .

  • Comparative performance: When compared to other targeting approaches like using elements from TatB in Arabidopsis thaliana or cyanobacterial signal sequences, PetC1 elements demonstrated superior performance for certain applications, including up to 21-fold increased protein accumulation .

  • Fusion flexibility: The modular nature of PetC1 elements (transmembrane domain, signal peptide, full protein) provides design flexibility not always available with other targeting systems .

These distinctive characteristics make PetC1 particularly valuable for targeting complex redox enzymes that benefit from the quality control features of the Tat pathway and stable thylakoid membrane integration .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.