Recombinant Synechocystis sp. Cytochrome b6-f complex iron-sulfur subunit 2 (petC2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petC2; sll1316; Cytochrome b6-f complex iron-sulfur subunit 2; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 2; ISP 2; RISP 2; Rieske iron-sulfur protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
petC2
Target Protein Sequence
MTQISGSPDVPDLGRRQFMNLLTFGTITGVAAGALYPAVKYLIPPSSGGSGGGVTAKDAL GNDVKVTEFLASHNAGDRVLAQGLKGDPTYIVVQGDDTIANYGINAVCTHLGCVVPWNAS ENKFMCPCHGSQYNAEGKVVRGPAPLSLALAHATVTDDDKLVLSTWTETDFRTDEDPWWA
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.

Database Links
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is the function of petC2 in the cytochrome b6-f complex of Synechocystis sp.?

The petC2 gene encodes the iron-sulfur subunit 2 of the cytochrome b6-f complex in Synechocystis sp. This protein contains a Rieske-type iron-sulfur cluster [2Fe-2S] that plays a critical role in electron transfer during photosynthesis. Within the cytochrome b6-f complex, the iron-sulfur subunit participates in the oxidation of plastoquinol at the Q𝑝 site, transferring electrons from plastoquinol to plastocyanin during the photosynthetic electron transport chain. This process is fundamental to energy conversion in photosynthetic organisms, linking photosystem II to photosystem I .

The cytochrome b6-f complex acts as a plastoquinol-plastocyanin oxidoreductase, facilitating electron flow through the thylakoid membrane while simultaneously contributing to the formation of a proton gradient necessary for ATP synthesis. As revealed by high-resolution cryo-EM structures, the complex functions through a proposed "one-way traffic model" that explains efficient quinol oxidation during both photosynthesis and respiration .

How does petC2 differ from petC1 in Synechocystis sp.?

PetC2 is an isoform of the Rieske iron-sulfur protein in Synechocystis sp. While petC1 is the dominant form expressed under standard growth conditions, petC2 represents an alternative isoform that can be differentially expressed under specific environmental conditions or stresses. The two isoforms share significant sequence homology but differ in certain key amino acid residues that may influence their redox potential, protein-protein interactions, and ultimately their function within the cytochrome b6-f complex.

These differences in amino acid composition between petC1 and petC2 are thought to provide metabolic flexibility to Synechocystis sp., allowing the organism to optimize electron transport under varying environmental conditions. Research indicates that the expression patterns of these isoforms can be regulated by factors such as light intensity, nutrient availability, and redox state of the cell.

What expression systems are suitable for recombinant production of petC2 from Synechocystis sp.?

Several expression systems have been successfully employed for the recombinant production of cyanobacterial proteins, including petC2. Based on current research methodologies, the following systems have demonstrated effectiveness:

  • Homologous expression in Synechocystis sp. PCC 6803: Using native regulatory elements such as the copper-inducible petE promoter system. This approach maintains the native cellular environment for proper folding and post-translational modifications. The petE promoter shows approximately 5× induction in the presence of copper, making it suitable for controlled expression .

  • Rhamnose-inducible system in Synechocystis: The rhaBAD system, adapted from E. coli, has been successfully implemented in Synechocystis sp. PCC 6803. When RhaS is expressed from a strong constitutive promoter like J23119, this system can achieve up to 55× induction, providing excellent control over expression levels .

  • E. coli-based expression: For structural studies requiring higher protein yields, E. coli expression systems using vectors such as pTrclS have been effective. This system includes the aadA gene encoding streptomycin resistance as an additional selection marker, which significantly improves the selection of desired transformants .

Each system has distinct advantages depending on research objectives. Homologous expression preserves native folding environments but may yield lower protein quantities, while heterologous E. coli expression typically produces higher yields but may present challenges in proper folding of membrane-associated proteins.

What are the most effective protocols for purifying recombinant petC2 while maintaining its structural integrity?

Purification of recombinant petC2 requires careful consideration of its membrane association and iron-sulfur cluster stability. Based on established protocols for similar proteins in the cytochrome b6-f complex, the following methodological approach is recommended:

  • Cell disruption and membrane isolation:

    • Sonication in a buffer containing protease inhibitors (benzamidine, ε-aminocaproic acid, and PMSF; 1 mM each)

    • Ultracentrifugation at approximately 148,000×g to isolate membrane fractions

    • Careful temperature control throughout the process (4°C)

  • Membrane protein solubilization:

    • Use of mild detergents such as n-dodecyl-β-D-maltoside (β-DDM) or digitonin

    • Gradual solubilization with detergent:protein ratios optimized to prevent denaturation

    • Incubation period of 30-60 minutes with gentle agitation

  • Chromatographic purification:

    • Initial capture using ion exchange chromatography

    • Affinity chromatography if a suitable tag (His-tag or Strep-tag) has been incorporated

    • Size exclusion chromatography for final purification and buffer exchange

    • Collection of specific fractions containing pure protein, as indicated by characteristic spectral properties

  • Validation of structural integrity:

    • Optical spectroscopy to confirm the presence of intact iron-sulfur clusters

    • Electron paramagnetic resonance (EPR) spectroscopy at low temperature (approximately 10K) to assess the integrity of the [2Fe-2S] cluster

    • Biochemical activity assays to confirm functionality

This multi-step approach has been shown to effectively isolate intact cytochrome b6-f complex components while preserving their structural and functional properties for downstream analyses .

How can researchers overcome the challenges of iron-sulfur cluster integrity during recombinant expression of petC2?

Maintaining iron-sulfur cluster integrity during recombinant expression of petC2 presents significant challenges that can be addressed through several strategic approaches:

  • Co-expression with iron-sulfur cluster assembly machinery:

    • Include genes for iron-sulfur cluster assembly (ISC or SUF system components)

    • Ensure adequate expression of scaffold proteins and cysteine desulfurases

    • Consider using specialized E. coli strains with enhanced iron-sulfur cluster assembly capacity

  • Media supplementation and growth conditions:

    • Supplement growth media with iron (ferric ammonium citrate, 0.1-0.5 mM)

    • Include additional sulfur sources if necessary

    • Maintain microaerobic or anaerobic conditions during expression to prevent oxidative damage

    • Implement lower growth temperatures (16-25°C) to slow protein synthesis and allow proper folding

  • Induction and expression strategies:

    • Use controlled, moderate induction rather than strong overexpression

    • In Synechocystis, the rhamnose-inducible rhaBAD system allows fine-tuning of expression levels

    • For copper-regulated petE promoter systems, optimize copper concentration for balanced expression

  • Post-harvest stabilization:

    • Include reducing agents (DTT, 2-mercaptoethanol) in all buffers

    • Add glycerol (10-20%) to stabilize protein structure

    • Work under anaerobic conditions when possible during purification

    • Consider chemical reconstitution of damaged clusters using established protocols

By implementing these methodological approaches, researchers can significantly improve the yield of correctly folded petC2 with intact iron-sulfur clusters, enabling more reliable structural and functional analyses.

What spectroscopic methods are most informative for characterizing the redox properties of recombinant petC2?

Characterization of the redox properties of recombinant petC2 requires a combination of complementary spectroscopic techniques to fully understand its electronic structure and functional capabilities:

  • UV-Visible Absorption Spectroscopy:

    • Provides characteristic spectra for monitoring oxidation state changes

    • Measurements at room temperature using diode array spectrophotometers

    • Comparison between oxidized (potassium ferricyanide-treated) and reduced (sodium dithionite-treated) states

    • Specific absorption bands associated with the [2Fe-2S] cluster can be monitored (typically 320-500 nm range)

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Critical for detailed characterization of paramagnetic [2Fe-2S]+ reduced state

    • Measurements at low temperature (10K) using X-band EPR

    • Typical parameters: microwave frequency ~9.39 GHz; microwave power ~6.35 mW; modulation amplitude ~1.5 mT at 100 kHz

    • Analysis of g-values characteristic of Rieske-type [2Fe-2S] clusters (g = 2.02, 1.89, 1.81)

    • Quantitative analysis of signal intensity for determination of reduction potentials

  • Protein Film Voltammetry:

    • Direct measurement of electron transfer properties

    • Determination of midpoint potentials and electron transfer kinetics

    • Assessment of pH dependence of redox potential, crucial for Rieske proteins

    • Investigation of electrochemical behavior under varying conditions

  • Resonance Raman Spectroscopy:

    • Analysis of Fe-S vibrational modes to assess cluster integrity and environment

    • Differentiation between different types of iron-sulfur clusters

    • Detection of subtle structural changes in different redox states

    • Non-destructive method allowing for sample recovery

These complementary spectroscopic approaches provide comprehensive characterization of the redox properties of petC2, enabling researchers to understand its electron transfer capabilities, structural integrity, and potential functional differences compared to the petC1 isoform.

What are the optimal conditions for assessing the activity of recombinant petC2 in vitro?

Assessing the activity of recombinant petC2 requires careful recreation of its native electron transfer environment. The following methodological approach provides a robust framework for in vitro activity measurements:

  • Preparation of electron donors and acceptors:

    • Plastoquinol donor: Decylplastoquinone dissolved in ethanol and reduced to decylplastoquinol (dPQH₂) using hydrogen gas with platinum on carbon as catalyst

    • Plastocyanin acceptor: Purified and oxidized with potassium ferricyanide, followed by removal of excess oxidant through concentration-dilution cycles using microconcentrators (10-kDa cutoff)

  • Reaction conditions:

    • Buffer composition: 30 mM Tris-HCl pH 7.5, 50 mM NaCl, 0.2 mM MgSO₄, 0.05% β-DDM

    • Temperature: 25°C (controlled)

    • Plastocyanin concentration: 10 μM (oxidized form)

    • Decylplastoquinol concentration: 25 μM

    • PetC2 concentration: 10-20 nM (referring to the concentration of active protein)

  • Measurement approach:

    • Spectrophotometric monitoring of plastocyanin reduction at 597 nm

    • Reaction initiation by addition of petC2 to the prepared reaction mixture

    • Determination of initial rates from the linear portion of the reaction progress curve

    • Calculation of turnover rates (electrons transferred per second per protein)

  • Controls and validation:

    • Negative controls lacking either substrate or enzyme

    • Comparison with native cytochrome b6-f complex activity

    • Inhibitor studies using specific cytochrome b6-f inhibitors (e.g., DBMIB)

    • Assessment of activity under varying pH and ionic strength conditions

Using this methodological framework, researchers can reliably measure the electron transfer activity of recombinant petC2, allowing for comparative analyses between different protein variants or between petC1 and petC2 isoforms. Typical turnover rates for the native cytochrome b6-f complex are approximately 120 electrons per second , providing a benchmark for recombinant protein activity.

How can researchers effectively compare the functional differences between petC1 and petC2 in vivo?

Comparing the functional differences between petC1 and petC2 in vivo requires sophisticated genetic manipulation and phenotypic characterization techniques:

  • Generation of genetic variants:

    • Creation of single knockout mutants (ΔpetC1 and ΔpetC2)

    • Double knockout complemented with either isoform (ΔpetC1ΔpetC2 + petC1 or ΔpetC1ΔpetC2 + petC2)

    • Site-directed mutagenesis of key residues in each isoform

    • Construction of petC1-petC2 chimeric proteins to identify functional domains

  • Expression control systems:

    • Use of inducible promoters such as the rhamnose-inducible rhaBAD system (55× induction) or copper-inducible petE promoter (5× induction)

    • Implementation of constitutive promoters with different strengths for comparative expression

    • Monitoring of expression levels using reporter proteins or quantitative RT-PCR

  • Phenotypic characterization:

    • Growth rate analysis under various light intensities and spectral qualities

    • Photosynthetic efficiency measurements (oxygen evolution, P700 re-reduction kinetics)

    • Electron transport rate determination using PAM fluorometry

    • Adaptation responses to environmental stresses (high light, nutrient limitation, temperature)

  • Advanced analytical techniques:

    • In vivo spectroscopic analysis of electron transport components

    • Blue-native PAGE combined with activity staining for complex assembly analysis

    • Thylakoid membrane proteomics to assess complex stoichiometry

    • Metabolomic profiling to identify downstream metabolic differences

  • Data analysis framework:

    Analysis ParameterΔpetC1ΔpetC2ΔpetC1ΔpetC2 + petC1ΔpetC1ΔpetC2 + petC2
    Growth rate (doubling time, h)
    O₂ evolution (μmol O₂ mg⁻¹ Chl h⁻¹)
    Electron transport rate (μmol e⁻ mg⁻¹ Chl h⁻¹)
    Cytochrome b6-f content (% of WT)
    PSI:PSII ratio
    High light sensitivity
    Redox state of PQ pool (% reduced)

This comprehensive approach enables researchers to systematically dissect the functional differences between petC1 and petC2, revealing their specific roles under different physiological conditions and environmental contexts.

What are the most reliable approaches for studying protein-protein interactions involving petC2 within the cytochrome b6-f complex?

Understanding the protein-protein interactions of petC2 within the cytochrome b6-f complex requires a multi-faceted approach combining structural, biochemical, and biophysical techniques:

  • Cross-linking coupled with mass spectrometry (XL-MS):

    • Application of specific cross-linkers (BS3, DSS, or EDC) to capture transient interactions

    • Digestion of cross-linked complexes followed by LC-MS/MS analysis

    • Identification of cross-linked peptides using specialized software (e.g., pLink, Kojak)

    • Mapping of interaction sites to structural models

  • Co-immunoprecipitation and pull-down assays:

    • Development of specific antibodies against petC2 or use of epitope tags

    • Gentle solubilization of membrane complexes with appropriate detergents

    • Immunoprecipitation followed by SDS-PAGE and mass spectrometry

    • Reciprocal pull-downs to confirm interactions

  • Surface plasmon resonance (SPR) and microscale thermophoresis (MST):

    • Quantitative measurement of binding kinetics and affinities

    • Determination of dissociation constants (Kd) between petC2 and interacting partners

    • Investigation of the effects of mutations on binding properties

    • Assessment of interaction dependencies on redox state and environmental conditions

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Analysis of solvent accessibility and conformational dynamics

    • Identification of protected regions indicating protein-protein interfaces

    • Detection of allosteric effects upon partner binding

    • Temporal resolution of binding-induced conformational changes

  • Cryo-electron microscopy:

    • Structural analysis of the entire cytochrome b6-f complex

    • Comparison between complexes containing petC1 versus petC2

    • Identification of structural adjustments accommodating different isoforms

    • Visualization of plastoquinone binding and electron transport pathways

  • Computational approaches:

    • Molecular dynamics simulations of petC2 interactions

    • Protein-protein docking to predict interaction interfaces

    • Electrostatic and hydrophobic complementarity analysis

    • Evolutionary coupling analysis to identify co-evolving residues

These complementary approaches provide a comprehensive understanding of how petC2 interacts with other components of the cytochrome b6-f complex and with its electron transfer partners, revealing both structural relationships and functional mechanisms that underlie its role in photosynthetic electron transport.

What are the current limitations in structural studies of recombinant petC2 and how might they be overcome?

Structural studies of recombinant petC2 face several significant challenges that require innovative methodological solutions:

  • Membrane protein crystallization barriers:

    • Limited success in obtaining well-diffracting crystals of membrane proteins

    • Solution approach: Implementation of lipidic cubic phase crystallization, bicelle methods, or crystallization in detergent micelles with strategic engineering of crystal contacts through fusion proteins or antibody fragments

  • Iron-sulfur cluster instability:

    • Oxidative damage during purification and crystallization processes

    • Solution approach: Strict anaerobic handling, inclusion of reducing agents, and development of rapid crystallization protocols that minimize exposure time

  • Heterogeneity in recombinant preparation:

    • Variable occupancy of iron-sulfur clusters and conformational heterogeneity

    • Solution approach: Implementation of additional purification steps focusing on protein homogeneity rather than just purity, including analytical SEC-MALS to select monodisperse fractions

  • Context-dependent structure:

    • petC2 structure may differ when isolated versus within the complete cytochrome b6-f complex

    • Solution approach: Cryo-EM studies of the intact complex with defined petC2 incorporation, potentially using genetic approaches to ensure petC2 versus petC1 inclusion

  • Dynamic nature of electron transfer proteins:

    • Important functional states may be transient and difficult to capture

    • Solution approach: Time-resolved structural methods, including TR-SFX at X-ray free-electron lasers or cryo-trapping of intermediate states

  • Limited comparison data:

    • Lack of direct structural comparisons between petC1 and petC2 isoforms

    • Solution approach: Parallel structural studies of both isoforms using identical methods, coupled with computational modeling of differences

These methodological approaches represent the cutting edge of structural biology techniques applied to challenging membrane protein complexes, offering pathways to overcome current limitations in our structural understanding of petC2 and its role within the cytochrome b6-f complex.

How can researchers effectively investigate the differential expression and regulation of petC1 versus petC2 under varying environmental conditions?

Investigating the differential expression and regulation of petC1 versus petC2 requires a comprehensive multi-omics approach combined with precise environmental control systems:

  • Transcriptomic analysis:

    • RNA-Seq under defined environmental conditions (light intensity, spectral quality, nutrient availability, temperature)

    • Time-course studies during adaptation to changing conditions

    • Single-cell RNA-Seq to assess population heterogeneity in expression

    • Comparison of transcriptional responses between wild-type and regulatory mutants

  • Promoter analysis and transcriptional regulation:

    • Reporter gene fusions to petC1 and petC2 promoters

    • Chromatin immunoprecipitation sequencing (ChIP-Seq) to identify transcription factor binding

    • DNA affinity purification sequencing (DAP-Seq) to map regulatory protein binding sites

    • Site-directed mutagenesis of putative regulatory elements

  • Proteomics approaches:

    • Targeted quantitative proteomics (PRM or SRM) for precise quantification of petC1 and petC2 levels

    • Global proteomics to identify co-regulated proteins

    • Phosphoproteomics to assess post-translational regulation

    • Pulse-chase experiments to determine protein turnover rates

  • Environmental control systems:

    • Photobioreactors with precise control of light intensity, quality, and photoperiod

    • Turbidostat cultivation for steady-state growth under defined conditions

    • Controlled nutrient limitation studies (iron, nitrogen, phosphorus)

    • Temperature shift experiments with high temporal resolution sampling

  • Data integration framework:

    ConditionpetC1:petC2 mRNA ratiopetC1:petC2 protein ratioCytochrome b6-f activityPhotosynthetic efficiency
    Standard growth
    High light
    Iron limitation
    Nitrogen limitation
    Low temperature
    Oxidative stress
  • Genetic validation:

    • CRISPR interference for targeted repression of regulatory factors

    • Overexpression of transcriptional regulators

    • Promoter swapping between petC1 and petC2

    • Construction of reporter strains with fluorescent proteins to enable real-time monitoring of expression dynamics

This integrated approach provides a comprehensive view of the regulatory networks controlling petC1 versus petC2 expression, revealing how environmental signals are transduced into specific gene expression patterns that optimize photosynthetic electron transport under changing conditions.

How might synthetic biology approaches be used to engineer optimized variants of petC2 for enhanced photosynthetic efficiency?

Synthetic biology offers powerful tools for engineering optimized petC2 variants with enhanced photosynthetic properties:

These synthetic biology approaches offer significant potential for creating petC2 variants with enhanced properties, potentially contributing to improved photosynthetic efficiency in both natural and artificial photosynthetic systems.

What methodological considerations are important when investigating the role of petC2 in artificial photosynthetic systems?

Investigating the role of petC2 in artificial photosynthetic systems requires specialized methodological approaches that bridge biological and material sciences:

  • Protein immobilization strategies:

    • Oriented attachment to electrodes via engineered affinity tags

    • Incorporation into nanoporous materials that mimic thylakoid architecture

    • Reconstitution into liposomes or nanodiscs for membrane-like environments

    • Development of covalent attachment methods that preserve protein structure and function

  • Interfacial electron transfer characterization:

    • Electrochemical impedance spectroscopy to quantify electron transfer resistance

    • Scanning electrochemical microscopy for spatial resolution of activity

    • Time-resolved spectroelectrochemistry to capture electron transfer kinetics

    • Advanced scanning probe microscopy for single-molecule studies

  • System integration considerations:

    • Compatible redox mediators for efficient electron transfer to electrodes

    • Co-immobilization with partner proteins from the photosynthetic electron transport chain

    • Interface engineering to minimize energy losses

    • Long-term stability enhancement through protein engineering or protective matrices

  • Performance metrics:

    • Quantification of electron transfer rates under different applied potentials

    • Determination of quantum efficiency in light-driven systems

    • Assessment of operational stability over extended timeframes

    • Comparison with other biological and synthetic catalysts

  • Advanced characterization techniques:

    • In situ spectroscopic methods to monitor redox states during operation

    • QCM-D for real-time monitoring of protein adsorption and conformational changes

    • Neutron reflectometry to characterize protein orientation at interfaces

    • Advanced microscopy techniques to visualize molecular organization

  • Comparative assessment framework:

    System componentCurrent density (μA/cm²)Onset potential (V vs. SHE)Operational stability (t₅₀, h)Quantum efficiency (%)
    PetC2 wild-type
    PetC2 engineered variant A
    PetC2 with optimized interface
    PetC2 in biomimetic matrix
    Synthetic catalyst reference

These methodological approaches enable systematic investigation of petC2's role in artificial photosynthetic systems, providing insights that can guide the development of bio-inspired catalysts and hybrid biological-inorganic systems for solar energy conversion and storage.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.