Recombinant Synechocystis sp. Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Genetic and Functional Characterization

PlsY in Synechocystis sp. PCC 6803 (encoded by slr1510) belongs to the acyl-phosphate-dependent glycerol-3-phosphate acyltransferase (GPAT) family. Phylogenetic analysis reveals its distinction from acyl-ACP-dependent GPATs like PlsB in E. coli, highlighting its unique role in cyanobacterial lipid metabolism . Key features include:

  • Substrate Specificity: Utilizes acyl-phosphate as the acyl donor, unlike plant or algal GPATs that rely on acyl-ACP .

  • Pathway Integration: Works with PlsX (acyl-phosphate synthase) to supply acyl groups for LPA synthesis, a precursor for phospholipids and glycolipids .

Enzyme Activity and Assays

Studies on homologous systems (e.g., Bacillus subtilis) demonstrate PlsY’s catalytic mechanism and essentiality:

ParameterObservationSource
LPA SynthesisMembrane fractions of ΔplsY mutants lack G3P acylation activity, confirming PlsY’s necessity .
Acyl Donor PreferenceActivity is highest with palmitoyl-phosphate (16:0) as the substrate .
Co-Expression with PlsXEnables complementation of E. coli lipid biosynthesis mutants, restoring growth .

Metabolic Engineering Applications

Recombinant PlsY has been leveraged to enhance lipid production in Synechocystis through strategic gene overexpression:

  • Co-Overexpression with PlsX/PlsC: Co-expression of plsX (acyl-phosphate synthase) and plsC (1-acyl-sn-glycerol-3-phosphate acyltransferase) in Synechocystis increased phosphatidic acid (PA) synthesis, boosting membrane lipid content by 1.5-fold .

  • Synergy with Carbon Fixation Pathways: Overexpression of plsY alongside Calvin-Benson-Bassham (CBB) cycle genes (e.g., glpD, rbcLXS) enhanced carbon flux toward lipid precursors, improving biomass and lipid yields .

Research Findings and Comparative Analysis

Key outcomes from engineered Synechocystis strains include:

Strain/ModificationLipid Content (% DCW)Growth RateKey Insight
Wild Type~10%BaselineBaseline lipid synthesis .
PlsX/PlsC Co-Overexpression15%UnaffectedEnhanced PA production .
Triple Overexpression (CBB + PlsY)24.5% (FFAs)IncreasedSynergistic carbon channeling .

Biotechnological Implications

  • Biofuel Production: Recombinant PlsY facilitates high lipid titers in cyanobacteria, enabling sustainable biofuel platforms .

  • Stress Tolerance: Strains with upregulated PlsY show improved resilience under nutrient deprivation (e.g., nitrogen limitation), correlating with lipid droplet accumulation .

  • Evolutionary Insight: PlsY’s divergence from plant/algal GPATs underscores horizontal gene transfer limitations in phototroph evolution .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
plsY; sll1973; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-222
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
plsY
Target Protein Sequence
MTTALLLCLCLLLITYLMGSIPTGYLAGKLLLGIDIREHGSKSTGATNVFRTLGKPAAIA VLAIDISKGVMAVALVRAIYSGDWLPALPAAWQNWLTLGVAIAVVLGHSKSIFLKFSGGK SVATSLGVLFMLNIWLALGTLATFLTVIFFTRIVSLSSIVAAIAVNGIALALQLPPPYLA FTFLAGMYVIVRHRTNIERILQGTEPKLGEKVSSVPDRKGVA
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of Glycerol-3-phosphate acyltransferase (plsY) in Synechocystis sp. lipid metabolism?

Glycerol-3-phosphate acyltransferase (plsY) catalyzes the first step in phospholipid biosynthesis in Synechocystis sp. by transferring an acyl group from acyl-ACP to glycerol-3-phosphate (Gro3P), forming lysophosphatidic acid. This reaction represents a critical junction between glycolysis and lipid synthesis pathways. In Synechocystis, plsY activity directly influences membrane phospholipid composition and is interconnected with fatty acid synthesis II (FAS II) pathways. Notably, Gro3P serves as a substrate not only for lipid biosynthesis but also for other metabolic pathways including starch and glycogen biosynthesis, isoprene and carotenoid synthesis .

How does plsY expression interact with other lipid biosynthesis genes in Synechocystis?

plsY expression in Synechocystis operates within a complex network of lipid biosynthesis genes. The pathway begins with acetyl-CoA being converted to malonyl-CoA by acetyl-CoA carboxylase (ACC), followed by multiple steps of fatty acid synthesis II (FAS II) to obtain fatty acyl-ACP, which serves as a substrate for phospholipid synthesis and minor alkane production . plsY works in concert with genes like aas (encoding acyl-ACP synthetase), which is involved in free fatty acid recycling. Engineering approaches that manipulate plsY expression alongside other genes such as glpD (encoding glycerol-3-phosphate dehydrogenase) can synergistically enhance lipid production by balancing both lipid synthesis and free fatty acid secretion pathways .

What are the structural characteristics of plsY in Synechocystis compared to other organisms?

plsY in Synechocystis sp. belongs to a conserved family of membrane-associated acyltransferases found across bacteria. The protein features characteristic transmembrane domains and conserved acyltransferase motifs. Unlike the universal glycerol-3-phosphate acyltransferase (GPAT) found in eukaryotes, the cyanobacterial plsY exhibits distinct structural properties optimized for its photosynthetic lifestyle. Phylogenetic analysis of similar enzymes shows that cyanobacterial acyltransferases often form distinct clades separate from their counterparts in plants and other bacteria, suggesting evolutionary divergence in response to the unique cellular environment of photosynthetic microorganisms .

What are the optimal conditions for expressing recombinant plsY from Synechocystis in heterologous systems?

Expressing recombinant plsY from Synechocystis in heterologous systems requires careful optimization of multiple parameters. For E. coli expression systems, using vectors like pQE12 with appropriate Shine-Dalgarno sequences upstream of the target gene helps ensure efficient translation . Codon optimization may be necessary due to the GC-rich nature of Synechocystis genes. Temperature control is critical—expression at lower temperatures (16-20°C) often improves protein folding of membrane-associated proteins like plsY.

Co-expression with chaperonins such as GroES and GroEL significantly enhances proper folding and activity. This can be achieved using compatible plasmids like pGroESL, with selection maintained using appropriate antibiotics such as chloramphenicol (70 μg/ml) alongside the primary selection marker . For optimal membrane integration, using E. coli strains with intact membrane protein assembly machinery (such as C41(DE3) or C43(DE3)) produces better results than standard laboratory strains.

How can CRISPR-Cas9 technology be applied to study plsY function in Synechocystis?

CRISPR-Cas9 technology offers precise genome editing capabilities for studying plsY function in Synechocystis. To implement this approach, researchers should first identify PAM sites within or adjacent to the plsY gene and design appropriate sgRNAs. The CRISPR-Cas9 system can be introduced via shuttle vectors compatible with Synechocystis transformation. For gene knockout studies, designing homology-directed repair templates with antibiotic resistance cassettes enables selection of successfully edited cells.

For more nuanced studies of plsY function, CRISPR interference (CRISPRi) using catalytically inactive Cas9 (dCas9) allows for tunable repression of plsY expression without permanently altering the genome. This approach is particularly valuable for studying essential genes like plsY where complete knockout might be lethal. When introducing point mutations to study specific functional domains, incorporation of silent mutations that disrupt the PAM site prevents re-cutting by Cas9 after successful editing. Transformants should be verified through sequencing and physiological characterization to confirm the desired genomic modifications and their effects on lipid metabolism.

What approaches can be used to resolve protein purification challenges with recombinant plsY?

Purification of membrane-associated proteins like recombinant plsY presents significant challenges that require specialized approaches. A recommended strategy involves using a dual-tag system—combining an N-terminal His-tag for initial affinity purification with a C-terminal tag like Strep-tag II for secondary purification. This multi-step approach significantly reduces non-specific contaminants.

The choice of detergents is critical for maintaining protein structure and function during extraction from membranes. A systematic screening of detergents should include:

DetergentConcentration RangeBest For
DDM0.5-2%Initial extraction
LMNG0.01-0.05%Maintaining activity
Digitonin0.5-1%Native structure preservation
SMA copolymer2.5%Extracting native lipid environment

For recombinant plsY expressed with a polyhistidine tag, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with imidazole gradients (20-300 mM) removes weakly bound contaminants while preserving specific binding of the target protein . Following initial purification, size exclusion chromatography in buffers containing lipid additives like phosphatidylglycerol helps maintain the native conformation and enzymatic activity of plsY.

What expression systems provide optimal yields of functional recombinant plsY?

Several expression systems can be employed for producing functional recombinant plsY, with each offering distinct advantages. E. coli-based expression using pQE vectors with C-terminal histidine tags provides a convenient affinity purification system . When expressing plsY in E. coli, co-expression with chaperonins GroES and GroEL using compatible plasmids like pGroESL significantly improves protein folding and functionality .

For more complex studies requiring post-translational modifications, cell-free protein synthesis systems offer an alternative approach. These systems allow precise control over the reaction environment and can incorporate specialized lipids to support proper folding of membrane proteins like plsY. When using cell-free systems, supplementation with Synechocystis lipid extracts can further enhance the functionality of the expressed protein.

Homologous expression within Synechocystis itself provides the most native environment but typically yields lower protein quantities. This approach involves creating expression constructs with strong promoters like psbA2 and introducing them into Synechocystis through homologous recombination. Selection can be performed using appropriate antibiotics, with successful transformants verified through PCR and Western blotting to confirm expression levels.

How can enzyme kinetics of recombinant plsY be accurately measured?

Accurate measurement of recombinant plsY enzyme kinetics requires carefully designed assays that account for its membrane association and substrate preferences. A radiometric assay using 14C-labeled acyl-ACP provides the most sensitive detection of activity. The reaction mixture should contain purified recombinant plsY, glycerol-3-phosphate, radiolabeled acyl-ACP, and appropriate buffer components.

Alternative non-radioactive methods include coupled enzyme assays where plsY activity is linked to measurable changes in NADH absorbance through auxiliary enzymes. For continuous monitoring of reaction progress, fluorescent acyl-ACP analogs can be employed, though these may show slightly different kinetic parameters compared to native substrates.

When analyzing kinetic data, the membrane-associated nature of plsY necessitates consideration of potential substrate partitioning effects. Michaelis-Menten parameters should be determined across a range of substrate concentrations, with careful attention to potential substrate inhibition at higher concentrations. Multiple technical and biological replicates are essential due to the inherent variability in membrane protein assays.

What strategies can be used to evaluate the physiological impact of plsY mutations in Synechocystis?

Lipidomic analysis using liquid chromatography-mass spectrometry (LC-MS) allows comprehensive profiling of changes in membrane lipid composition resulting from plsY mutations. This approach can reveal subtle alterations in fatty acid chain length, saturation levels, and relative abundance of different phospholipid classes.

For functional assessment of photosynthetic performance, pulse-amplitude modulation (PAM) fluorometry measures changes in photosystem II efficiency. This non-invasive technique can detect stress responses and photosynthetic impairments resulting from altered membrane composition. Combined with transcriptomic analysis to identify compensatory gene expression changes, these approaches provide a holistic view of how plsY mutations affect cellular physiology and metabolism in Synechocystis.

What control experiments are essential when studying recombinant plsY activity?

When studying recombinant plsY activity, several critical control experiments must be included to ensure valid and interpretable results. Negative controls should include heat-inactivated enzyme preparations to establish baseline activity levels and identify potential non-enzymatic reactions. Substrate specificity controls using structurally related but non-reactive substrate analogs help confirm reaction specificity.

Expression of catalytically inactive plsY mutants (with mutations in conserved active site residues) provides important comparisons for distinguishing between specific and non-specific activities. When heterologously expressing plsY, parallel experiments with empty vector transformants are essential to account for background host enzyme activities.

For in vivo studies, complementation experiments where wild-type plsY is reintroduced into knockout or mutant strains verify that observed phenotypes are specifically attributable to plsY function rather than secondary effects. Time-course analyses should be included to establish linearity of enzyme reactions and determine appropriate sampling points for kinetic analyses.

How can researchers address solubility issues when working with recombinant plsY?

Addressing solubility issues with recombinant plsY requires multiple complementary approaches. Fusion partners such as maltose-binding protein (MBP) or NusA can significantly enhance solubility while maintaining enzymatic function. These fusion tags can later be removed using specific proteases if necessary for structural or functional studies.

Optimization of cell lysis conditions is crucial—using specialized detergents in a stepwise extraction protocol often yields better results than harsh mechanical disruption methods. A systematic detergent screening approach should be employed, testing different detergent types and concentrations for optimal extraction efficiency while preserving enzyme activity.

The table below summarizes effective solubilization strategies:

StrategyImplementationExpected Outcome
Fusion partnersN-terminal MBP or SUMO tagIncreased solubility, maintained structure
Expression temperatureLower to 16-18°CReduced inclusion body formation
Host strainC41(DE3) or SoluBL21Specialized for membrane proteins
Co-expressionGroEL/GroES chaperoninsImproved folding efficiency
Lysis bufferHEPES pH 7.5 with glycerolStabilized protein structure
Detergent extractionGraduated DDM/LMNG approachEfficient solubilization with activity retention

When working with particularly challenging constructs, refolding protocols starting from inclusion bodies offer an alternative approach. This involves solubilizing inclusion bodies in strong denaturants followed by controlled dilution into detergent-containing buffers to promote proper refolding.

How can researchers validate that recombinant plsY retains native structure and function?

Validating that recombinant plsY retains its native structure and function requires multiple complementary approaches. Circular dichroism (CD) spectroscopy provides information about secondary structure elements and can be compared with predicted structural features. Thermal stability assays using techniques like differential scanning fluorimetry help assess whether the recombinant protein exhibits expected stability characteristics.

Functional validation through enzyme activity assays is essential, comparing kinetic parameters of the recombinant enzyme with those reported for the native enzyme whenever possible. Substrate specificity profiles provide another important criterion—the recombinant enzyme should show the same preference patterns across different acyl-ACP chain lengths and saturation levels as the native enzyme.

For more detailed structural validation, limited proteolysis experiments can probe the accessibility of protease sites, providing information about protein folding. Properly folded proteins typically show resistance to proteolysis except at exposed loops and termini. When combined with mass spectrometry analysis of the resulting fragments, this approach can verify that the recombinant protein adopts a conformation consistent with its predicted structure.

How should researchers interpret contradictory results between in vitro and in vivo studies of plsY function?

When faced with contradictory results between in vitro and in vivo studies of plsY function, researchers should consider several explanatory factors. The cellular environment contains regulatory elements absent in purified systems—protein-protein interactions, allosteric regulators, and competitive inhibitors may substantially modify enzyme behavior in vivo. Additionally, substrate availability differs dramatically between the two contexts, with carefully controlled substrate concentrations in vitro versus dynamic metabolic pools in vivo.

Metabolic channeling, where substrates are directly transferred between enzymes without equilibrating with the bulk cellular environment, may exist in vivo but be disrupted in purified systems. Post-translational modifications present in the native environment might be missing from recombinant proteins, potentially altering activity or regulation.

When analyzing such discrepancies, researchers should implement a systematic approach beginning with validation of the recombinant protein's structure and activity using multiple complementary techniques. Cell-free expression systems incorporating native membrane components can provide an intermediate experimental context that bridges the gap between purified enzyme studies and complex cellular environments. Integrating data from multiple approaches—biochemical, genetic, and systems biology—often provides the most complete understanding of plsY function.

What statistical approaches are most appropriate for analyzing plsY enzyme kinetics data?

Analysis of plsY enzyme kinetics data requires statistical approaches that account for the unique characteristics of membrane-associated enzyme systems. Non-linear regression analysis of initial velocity versus substrate concentration data should be performed using models that account for potential substrate partitioning effects into membrane phases.

When comparing kinetic parameters (Km, Vmax, kcat) between different experimental conditions or enzyme variants, statistical significance should be assessed using appropriate tests. For normally distributed data, paired t-tests or ANOVA with post-hoc analysis (such as Tukey's test) are suitable. For non-normally distributed data, non-parametric alternatives like the Wilcoxon signed-rank test should be employed.

Power analysis should be conducted prior to experiments to determine the number of replicates required to detect biologically meaningful differences with statistical confidence. This is particularly important when comparing subtle differences between enzyme variants. Experimental design should include both technical replicates (repeated measurements of the same enzyme preparation) and biological replicates (measurements of independently prepared enzyme batches) to account for different sources of variability.

How might synthetic biology approaches expand our understanding of plsY function in cyanobacteria?

Synthetic biology approaches offer transformative potential for understanding plsY function in cyanobacteria. Designer minimal lipid synthesis pathways can be constructed by combining plsY with complementary enzymes from diverse organisms, allowing researchers to study fundamental mechanisms without confounding variables. These minimal systems can be systematically expanded to identify essential interactions and regulatory networks.

Orthogonal translation systems permit the incorporation of non-canonical amino acids at specific positions within plsY, enabling the introduction of photo-crosslinking groups, fluorescent probes, or chemical handles for precise functional studies. This technology allows researchers to map interaction surfaces and track conformational changes during catalysis.

Biosensor development using fluorescent proteins or transcription factors responsive to lipid pathway intermediates enables real-time monitoring of plsY activity in living cells. Such biosensors facilitate high-throughput screening of plsY variants and provide insights into metabolic dynamics under changing environmental conditions. Ultimately, these synthetic biology approaches could lead to engineered cyanobacteria with optimized membrane compositions for enhanced stress tolerance or bioproduction capabilities.

What emerging technologies might overcome current limitations in studying membrane-associated enzymes like plsY?

Several emerging technologies promise to overcome current limitations in studying membrane-associated enzymes like plsY. Cryo-electron microscopy advances now permit structural determination of membrane proteins at near-atomic resolution without the need for crystallization. This approach can capture plsY in multiple conformational states, providing dynamic insights into its catalytic mechanism.

Native mass spectrometry techniques combined with specialized ionization methods enable analysis of intact membrane protein complexes with associated lipids. This approach can reveal how specific lipid interactions influence plsY structure and function. Computational approaches including molecular dynamics simulations with specialized force fields for membrane environments can model plsY behavior within realistic lipid bilayers.

Single-molecule studies using techniques like total internal reflection fluorescence microscopy allow direct observation of individual enzyme molecules, revealing heterogeneity in behavior that might be masked in bulk measurements. When combined with microfluidic platforms for precise control of the chemical environment, these approaches can provide unprecedented insights into plsY dynamics and regulation under physiologically relevant conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.