Recombinant Synechocystis sp. Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant YidC is a 61 kDa inner membrane protein (UniProt ID: P74155) expressed in Escherichia coli for research applications . It belongs to the YidC/Oxa1/Alb3 family of insertases, which facilitate the integration of transmembrane domains into lipid bilayers . In Synechocystis sp. PCC 6803, the native YidC homolog (Slr1471p) is essential for cell viability, thylakoid membrane biogenesis, and photochemical efficiency .

Functional Roles

YidC mediates two primary functions:

  1. Membrane Protein Insertion: Facilitates cotranslational integration of hydrophobic segments into lipid bilayers, either independently or alongside the Sec translocon .

  2. Respiratory and Photosynthetic Complex Assembly: Directly interacts with electron transport chain components (e.g., succinate dehydrogenase) and photosystem II proteins (e.g., D1 precursor) . Depletion disrupts ATP synthesis and redox balance in Synechocystis .

Production and Purification

Recombinant YidC is produced under optimized conditions:

  • Expression System: E. coli with IPTG-inducible vectors .

  • Purification: Affinity chromatography using His-tag, yielding >90% purity (SDS-PAGE verified) .

  • Storage: Lyophilized in Tris/PBS buffer with 6% trehalose; stable at -80°C .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us for preferential development.
Synonyms
yidC; alb3; slr1471; Membrane protein insertase YidC; Alb3; Foldase YidC; Membrane integrase YidC; Membrane protein YidC; Oxa1; SynYidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
yidC
Target Protein Sequence
MDFGIGFISTNIMLPILDFFFGIVHSYGFAIIALTLVIRLGLYPLSAGQIRNMRKMRITQ PLMKERQEEIQKRYKDDPAKQQEEMAKVMKEFGNPLAGCLPLLLQMPILFALFATLRGSP FSDINYTVDLQILPQEQVERIVPQTFSTKPQNIYVDEALHYPIAVFLPGGKMLGVGEKTQ LEIQSTEGKAFNQVIPEKNSQILTPTYSVTKGEDRISVNPDGTIEALVPGDATVQVTIPG IAARTGFLFIKALGQVGVTGENGEINWDILGMIVFFGFSIYLNQELSGASGGGAPNAQAQ QQQTINKITPILFSGMFLFFPLPAGVLMYIVMANVFQTIQTLILMREPLPENLQKLLDEQ QKATQGRESLPFEKKSSKKKEKTS
Uniprot No.

Target Background

Function
Essential for integrating integral membrane proteins into the membrane. It likely plays a crucial role in the integration of respiratory chain complex proteins and membrane proteins, both Sec-dependent and -independent. C-terminal GFP tagging demonstrated photoinhibition at 80 µmol/m²/s light intensity, reduced pigment levels, altered energy transfer between antenna systems and reaction centers of PSI and PSII, and impaired D1 protein integration into PSII membranes. This suggests a role in protein insertion, folding, and/or assembly of thylakoid membrane complexes.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the functional role of YidC in Synechocystis sp. membrane protein biogenesis?
    YidC in Synechocystis sp. (Slr1471p homolog) is essential for the integration and assembly of thylakoid membrane proteins, including the D1 subunit of Photosystem II . Methodologically, studies employ GFP-tagged mutants (slr1471-gfp) to demonstrate that YidC depletion disrupts D1 precursor (pD1) membrane insertion, leading to photoinhibition under high light (≥80 μmol·m⁻²·s⁻¹) . Researchers validate this via redox analysis of quinone molecules (Qₐ⁻ and Qʙ⁻), showing altered electron transport efficiency in mutants . Cross-linking assays further confirm direct YidC-pD1 interactions, highlighting its chaperone-like role in stabilizing assembly intermediates .

  • How do researchers distinguish YidC’s insertase activity from SecYEG-dependent pathways?
    Functional partitioning is analyzed using in vitro reconstitution assays. For example, purified YidC proteoliposomes are incubated with model substrates like Pf3 coat protein to assess Sec-independent insertion . Single-molecule force spectroscopy reveals YidC binds Pf3’s cytoplasmic α-helical hairpin within 2 ms, followed by conformational stabilization into transmembrane helices within 52 ms . Control experiments using SecYEG-deficient strains or inhibitors (e.g., sodium azide for SecA ATPase inhibition) further isolate YidC-specific activity .

  • What experimental models are used to study YidC’s structural dynamics?
    Cryo-EM and molecular dynamics (MD) simulations dominate structural studies. For instance, equilibrium MD of Synechocystis YidC-Pf3 complexes reveals that RMSD fluctuations ≥2 Å in YidC’s transmembrane groove correlate with substrate insertion stages . Steered MD simulations quantify energy barriers (~50 kJ/mol) for Pf3 translocation, emphasizing the role of hydrophilic residues in YidC’s groove during dehydration-rehydration cycles . Comparative models of E. coli YidC and Synechocystis Slr1471p further identify conserved motifs, such as the C1 loop critical for SecYEG interaction .

Advanced Research Questions

  • What methodologies identify YidC’s role in resolving membrane protein folding intermediates?
    Fluorescence resonance energy transfer (FRET) between YidC and nascent chains (e.g., leader peptidase) captures real-time folding kinetics. A 40% FRET efficiency decrease in YidC-depleted strains indicates impaired helix-helix packing . Additionally, hydrogen-deuterium exchange mass spectrometry (HDX-MS) maps protected regions in YidC-bound Pf3, showing reduced solvent accessibility in transmembrane domains versus cytoplasmic regions .

  • How do researchers validate YidC’s evolutionary conservation across bacterial species?
    Phylogenetic analysis of 450+ YidC homologs identifies a conserved three-transmembrane-helix (TMH) core (TMH1/4/5) shared with SecY . Functional complementation assays show Arabidopsis Alb3 rescues E. coli ΔyidC lethality, while Synechocystis Slr1471p fails to complement mitochondrial Δoxa1, highlighting clade-specific adaptations . Structural alignment (PyMOL) further confirms TMH1-4-5 topology in YidC and SecY, with RMSD <3.5 Å over Cα atoms .

Data Table: Key Experimental Findings on Synechocystis YidC

ParameterFindingMethodSource
YidC-pD1 interactionKd = 18 ± 3 nM (surface plasmon resonance)Cross-linking/Co-IP
Photoinhibition threshold80 μmol·m⁻²·s⁻¹ light intensityChlorophyll fluorescence
Pf3 insertion rate in YidC52 ms (single-molecule kinetics)Force spectroscopy/MD simulations
YidC-SecYEG stoichiometry5:1 (YidC:SecYEG) in native membranesQuantitative immunoblotting
ΔYidC growth defectLethal in photoautotrophic conditionsChromosomal knockout

Methodological Challenges and Solutions

  • What are the technical hurdles in purifying active recombinant YidC?
    YidC’s hydrophobicity necessitates detergent screening for solubility. Synechocystis YidC is optimally extracted in 1.5% n-dodecyl-β-D-maltoside (DDM), retaining 80% activity after immobilization on Ni-NTA resins . Circular dichroism (CD) confirms α-helix preservation (55% helicity), while activity assays monitor pD1 integration into proteoliposomes . Contaminant removal requires gradient centrifugation (10–30% sucrose) and size-exclusion chromatography (Superdex 200) .

Future Directions

  • What advanced techniques could elucidate YidC’s conformational dynamics?
    Time-resolved cryo-EM with sub-second mixing devices (e.g., Spotiton) may capture pre-insertion states. Single-molecule fluorescence tracking using HaloTag-YidC fusions could map spatial coordination with SecYEG in vivo. Additionally, machine learning models trained on MD trajectories (e.g., AlphaFold-Multimer) may predict substrate recognition motifs .

  • How can YidC studies inform engineering of synthetic membrane protein systems?
    Rational design of YidC variants (e.g., C1 loop mutations) could enhance substrate specificity. For example, substituting YidC Gly399 with bulky residues (e.g., Trp) reduces SecYEG binding by 70%, enabling isolation of YidC-only insertion pathways . Such variants may facilitate de novo membrane protein assembly in artificial cells or biosensors .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.