Recombinant Synechocystis sp. Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ycf4; sll0226; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
ycf4
Target Protein Sequence
MGGQTLAESSQVLRQEVLGARRFSNFFWAGISTIGGVGFLLAGLSSYFGKNLLIVSDTTG LQFIPQGVALLFYGVAGSTVAGYLWLTMALNVGSGYNEFNKKSGQVTIFRWGFPGKNRRI ELINKIADVQAVKAEIKEGVNPKRSLYLKVKQRRDIPLTRAGQPISLSQLENQGAELARF LGVPLEGL
Uniprot No.

Target Background

Function

Appears essential for the assembly of the photosystem I complex.

Database Links
Protein Families
Ycf4 family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Ycf4 and what is its fundamental role in photosynthesis?

Ycf4 (hypothetical chloroplast open reading frame 4) is a thylakoid membrane protein essential for the assembly and accumulation of Photosystem I (PSI) complex in photosynthetic organisms. This protein plays a critical role in the biogenesis of PSI, acting as an assembly factor rather than a structural component of the final complex. In Chlamydomonas reinhardtii, Ycf4 is absolutely essential for PSI accumulation, as transformants lacking ycf4 are unable to grow photoautotrophically and are deficient in PSI activity . Biochemical analyses have revealed that Ycf4 is part of a large complex of >1500 kD that interacts with newly synthesized PSI polypeptides, assisting in their assembly into the functional PSI complex .

How conserved is Ycf4 across different photosynthetic organisms?

Ycf4 is highly conserved among photosynthetic organisms from cyanobacteria to higher plants . The protein is encoded by the chloroplast genome in eukaryotes, highlighting its evolutionary significance. Comparative sequence analyses have shown that the deduced amino acid sequence of Ycf4 from C. reinhardtii (197 residues) displays 41-52% sequence identity with homologues from various algae, land plants, and cyanobacteria . This high degree of conservation suggests that the functional role of Ycf4 in PSI assembly has been maintained throughout the evolution of photosynthetic organisms, although with some species-specific adaptations.

What is the genomic organization of the ycf4 gene?

In C. reinhardtii, the ycf4 gene is present as part of a polycistronic transcriptional unit on the chloroplast genome. Specifically, it exists within the rps9-ycf4-ycf3-rps18 gene cluster . This gene cluster is transcribed into two major RNA species of 8.0 kb and 3.0 kb, corresponding to the entire unit and to rps9-ycf4-ycf3, respectively . This genomic organization reflects the coordinated expression of genes involved in photosynthetic apparatus assembly and ribosomal proteins, suggesting regulatory linkages between translation and photosynthetic complex assembly.

What is known about the structure and localization of Ycf4?

Ycf4 is a 22-kD protein with two putative transmembrane domains and is localized on the thylakoid membrane . Despite its membrane association, biochemical studies have shown that both Ycf3 and Ycf4 are extrinsic membrane proteins, as they can be extracted from thylakoid membranes by treatment with alkali or chaotropic agents . Immunoblot analyses have confirmed that Ycf4 is associated with the thylakoid membrane but is not stably associated with the isolated PSI complex, suggesting that it functions in the assembly process rather than as a structural component of the mature complex .

What is the composition of the Ycf4-containing complex?

The Ycf4-containing complex in C. reinhardtii has been successfully purified and characterized using tandem affinity purification (TAP) technology . This complex is remarkably large (>1500 kD) and contains:

ComponentDescriptionFunction
Ycf4Assembly factor proteinPSI assembly mediation
COP2Opsin-related proteinPotential regulatory function
PsaAPSI core proteinCore component of PSI reaction center
PsaBPSI core proteinCore component of PSI reaction center
PsaCPSI subunitIron-sulfur center binding
PsaDPSI subunitFerredoxin binding
PsaEPSI subunitCyclic electron transport
PsaFPSI subunitPlastocyanin docking

Electron microscopy revealed that the largest structures in the purified Ycf4 complex preparation measure 285 × 185 Å, representing several large oligomeric states . The intimate and exclusive association of Ycf4 and COP2 was demonstrated by copurification through sucrose gradient ultracentrifugation and ion exchange chromatography .

How does the absence of Ycf4 affect photosynthesis and growth?

The phenotypic consequences of Ycf4 deficiency vary between species:

In C. reinhardtii:

  • Complete inability to grow photoautotrophically

  • Severe impairment of mixotrophic growth under moderate light (80 μE/m²/s)

  • Characteristic fluorescence pattern indicating PSI deficiency

  • Nearly undetectable accumulation of PSI subunits

In cyanobacteria:

  • Reduced but not eliminated PSI levels

  • Functional PSI complexes still present

  • Higher PSII/PSI ratio due to increased PSII levels

In tobacco:

  • Complete removal of Ycf4 results in plants that cannot grow autotrophically

  • Very slow growth even on artificial medium supplemented with sucrose

  • Contradicts earlier reports that suggested Ycf4 was non-essential in tobacco

These species-specific differences suggest that the dependence on Ycf4 for PSI assembly has evolved differently across photosynthetic lineages, with eukaryotic organisms showing greater dependence than prokaryotic cyanobacteria.

Does Ycf4 affect the expression of PSI genes or only assembly?

Multiple lines of evidence indicate that Ycf4 specifically affects PSI assembly/stability rather than gene expression:

  • RNA hybridization experiments demonstrated that transcripts of PSI genes (psaA, psaB, and psaC) accumulate normally in ycf4-deficient mutants .

  • Analysis of chimeric reporter genes showed that translation initiation of PSI component mRNAs is not affected by the absence of Ycf4 .

  • Pulse-chase protein labeling experiments revealed that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex .

These findings collectively indicate that Ycf4 functions at the post-translational level, specifically in the assembly and/or stability of the PSI complex rather than in the expression of PSI genes.

What are effective strategies for generating and confirming Ycf4 mutants?

Based on published methodologies, the following approaches have been successfully used:

  • Chloroplast transformation via biolistic method:

    • Disruption of ycf4 with a chloroplast selectable marker cassette (e.g., aadA)

    • Confirmation of homoplasmy through Southern blot analysis

  • Complete vs. partial gene deletion:

    • Complete removal of the ycf4 sequence encoding all 184 amino acids (as in tobacco)

    • Partial deletion strategies (e.g., removing 93 amino acids from N-terminal region)

  • Phenotypic verification:

    • Testing photoautotrophic growth capability

    • Measuring fluorescence transients of dark-adapted cells

    • Western blot analysis of PSI subunits

  • Complementation studies to confirm the specificity of the mutation effect

How can the Ycf4 protein complex be isolated and characterized?

The successful purification and characterization of the Ycf4 complex from C. reinhardtii was achieved using the following approach :

  • Generation of TAP-tagged Ycf4:

    • The TAP-tag consisting of calmodulin binding peptide and Protein A domains was fused to the C-terminus of Ycf4

    • Confirmation that the tagged protein maintains functionality through growth tests and PSI activity measurements

  • Two-step affinity purification protocol:

    • Solubilization of thylakoid membranes with n-dodecyl-β-D-maltoside (DDM)

    • First affinity chromatography using IgG agarose column

    • Cleavage with tobacco etch virus protease

    • Second affinity purification using calmodulin affinity resin

  • Analytical techniques for complex characterization:

    • Sucrose gradient ultracentrifugation

    • Ion exchange column chromatography

    • Mass spectrometry (LC-MS/MS) for protein identification

    • Immunoblotting for specific component verification

    • Transmission electron microscopy and single particle analysis for structural insights

This methodology yielded a highly purified Ycf4-containing complex and enabled the identification of its protein components and visualization of its structure .

What are the species-specific differences in Ycf4 function?

A notable finding in Ycf4 research is the differential requirement for this protein across photosynthetic lineages:

OrganismEffect of Ycf4 DeletionPSI AssemblyGrowth
C. reinhardtiiComplete PSI lossFully destabilizedNo photoautotrophic growth
CyanobacteriaReduced PSI levelsStill functionalPhotoautotrophic growth possible
TobaccoComplete PSI lossFully destabilizedNo photoautotrophic growth

This pattern of differential dependency extends to other photosynthetic components as well. For instance, the absence of PsaC, PsbK, and PsbO subunits has more severe effects in C. reinhardtii than in cyanobacteria . This suggests that eukaryotic chloroplasts may possess a "clearing system" that recognizes and degrades polypeptides of misassembled protein complexes, which is either absent or less efficient in cyanobacteria .

What is the proposed mechanism of Ycf4-mediated PSI assembly?

Based on cumulative research findings, several hypotheses have been proposed for how Ycf4 facilitates PSI assembly:

  • Platform for subunit interaction: Ycf4 may provide a physical platform where newly synthesized PSI polypeptides can interact properly during the initial stages of assembly .

  • Membrane insertion facilitation: The protein might be required for proper insertion of the PSI complex within the thylakoid membrane, potentially as part of a larger machinery .

  • Cofactor insertion: Ycf4 could be involved in the insertion of redox cofactors (chlorophyll dimer P700, electron acceptors A₀ and A₁, 4Fe-4S clusters) into the PSI complex .

  • Quality control function: Ycf4 might participate in a quality control mechanism that ensures only correctly assembled PSI complexes are integrated into the photosynthetic apparatus.

Pulse-chase protein labeling experiments have provided evidence that the PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled, supporting the role of this complex in an initial assembly step of PSI .

What are the remaining knowledge gaps in understanding Ycf4 function?

Despite significant progress, several aspects of Ycf4 function remain to be elucidated:

  • The detailed molecular mechanism by which Ycf4 facilitates PSI assembly is not fully understood.

  • The precise role of COP2 (the opsin-related protein) in the Ycf4 complex and its potential regulatory functions require further investigation.

  • The structural details of how Ycf4 interacts with PSI subunits during the assembly process remain to be determined.

  • The evolutionary basis for the differential dependency on Ycf4 across photosynthetic lineages needs further exploration.

What emerging technologies could advance Ycf4 research?

Several cutting-edge approaches could significantly enhance our understanding of Ycf4 function:

  • Cryo-electron microscopy: To obtain high-resolution structures of the Ycf4 complex during different stages of PSI assembly.

  • In vivo fluorescence tagging and super-resolution microscopy: To track the dynamic interactions between Ycf4 and PSI subunits in living cells.

  • Quantitative proteomics: To monitor changes in the composition of the Ycf4 complex under different physiological conditions.

  • CRISPR-Cas9 technology: For precise genome editing to create partial mutations and chimeric proteins to dissect domain-specific functions.

  • Synthetic biology approaches: To reconstitute minimal PSI assembly systems in vitro with purified components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.