Recombinant Synechocystis sp. Photosystem II 44 kDa reaction center protein (psbC)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of psbC

The psbC gene encodes CP43, a transmembrane protein integral to PSII. Key features include:

  • Molecular weight: 44 kDa (unprocessed precursor) .

  • Start codon: Translation initiates at a conserved GUG codon, 14 bases downstream of psbD-I, as confirmed by mutagenesis studies in Synechocystis sp. PCC 6803 .

  • Pigment binding: Binds 13–16 chlorophyll a molecules and β-carotene, forming part of PSII’s inner antenna system .

Recombinant Expression and Applications

Recombinant CP43 is utilized for structural and functional studies:

  • Expression systems: Produced in Synechocystis sp. PCC 6803 with partial sequences available commercially (e.g., MBS7062646 from MyBioSource) .

  • Biotechnological relevance:

    • Used to study PSII assembly intermediates and photoinhibition mechanisms .

    • Engineered strains lacking CP43 enable isolation of RC47 complexes for probing PSII biogenesis .

Genetic and Mutational Analysis

Mutation/ModificationObserved EffectSource
GUG → AUG (start codon)Loss of CP43 and photoautotrophic growth
T192H (D2 protein)PSII assembly failure; rescued by Slr2013 truncation
psbC deletionAccumulation of RC47 complexes lacking oxygen evolution

Challenges in Recombinant Production

  • Instability: Recombinant CP43 tends to aggregate without stabilizing subunits like Psb27 or Psb28 .

  • Pigment incorporation: Requires co-expression with chaperones (e.g., Slr2013) for proper chlorophyll binding .

Future Directions

  • Structural resolution: High-resolution cryo-EM of CP43 in native PSII dimers remains a priority .

  • Biochemical optimization: Enhancing recombinant yield and stability for industrial applications (e.g., biofuel production) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbC; sll0851; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-460
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
psbC
Target Protein Sequence
MVTLSNTSMVGGRDLPSTGFAWWSGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFEVA HFIPEKPMYEQGLILLPHIATLGWGVGPAGEVTDIFPFFVVGVLHLISSAVLGLGGIYHA LRGPEVLEEYSSFFGYDWKDKNQMTNIIGYHLILLGCGALLLVFKAMFFGGVYDTWAPGG GDVRVITNPTLNPAIIFGYLLKAPFGGEGWIISVNNMEDIIGGHIWIGLICISGGIWHIL TKPFGWARRALIWSGEAYLSYSLGALSLMGFIASVFVWFNNTAYPSEFYGPTGMEASQSQ AFTFLVRDQRLGANIASAQGPTGLGKYLMRSPSGEIIFGGETMRFWDFRGPWLEPLRGPN GLDLDKLRNDIQPWQVRRAAEYMTHAPLGSLNSVGGVITDVNSFNYVSPRAWLATSHFVL GFFFLVGHLWHAGRARAAAAGFEKGIDRETEPTLFMPDLD
Uniprot No.

Target Background

Function
This protein is a key component of the core complex in photosystem II (PSII). It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical reactions within PSII. PSII is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, producing O2 and a proton gradient that is subsequently used for ATP formation. This protein is essential for the correct assembly of PSII.
Database Links
Protein Families
PsbB/PsbC family, PsbC subfamily
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional role of psbC-encoded CP43 protein within the Photosystem II complex?

The CP43 protein functions as a proximal antenna that transfers excitation energy from peripheral light-harvesting complexes to the reaction center. It contains six transmembrane helices that coordinate approximately 13 chlorophyll a molecules and several β-carotene molecules. The protein plays a critical role in the structural stability of the PSII core complex while facilitating energy transfer to the reaction center. Additionally, CP43 contributes to the coordination of the Mn₄CaO₅ cluster, which forms the catalytic center for water oxidation. This coordination occurs through CP43-Glu354, which provides a ligand to Mn3 in the metal cluster . When studying CP43 function, researchers should employ both spectroscopic and structural biology approaches to fully characterize its dual roles in energy transfer and structural support.

How does psbC expression change during different growth phases in Synechocystis?

Growth PhaseRelative psbC ExpressionKey Regulatory Factors
Early LogModerate (baseline)Light intensity dependent
Mid-LogHigh (1.5-2× baseline)Nutrient availability
Late LogDecreasing (0.7-0.9× baseline)Influenced by cell density
StationaryLow (0.3-0.5× baseline)Stress response activation

Expression analysis should be performed using RT-qPCR with appropriate reference genes such as rnpB or secA. When designing experiments to study psbC expression, researchers should carefully control light conditions, as sudden changes in light intensity can trigger rapid transcriptional responses that may confound results.

What structural elements of psbC are essential for proper integration into the PSII complex?

The integration of CP43 into the PSII complex depends on several critical structural elements. The large extrinsic E-loop between transmembrane helices 5 and 6 is particularly important for interaction with the D1 protein and stabilization of the oxygen-evolving complex. The transmembrane helices must be properly folded for chlorophyll binding and positioning within the complex. Specific residues in CP43 form coordination bonds with chlorophyll molecules, and mutations in these residues can dramatically impair energy transfer efficiency.

Recent structural studies using serial femtosecond crystallography have revealed that the CP43 protein contributes significantly to the formation of water channels that deliver substrate water to the Mn₄CaO₅ cluster . In particular, the O1 and O4 channels show concerted movements of water molecules during S-state transitions, highlighting CP43's role in substrate delivery. For successful integration studies, researchers should consider both the structural integrity of isolated CP43 and its dynamic interactions with other PSII subunits.

How can researchers effectively express and purify recombinant CP43 protein while maintaining its functional integrity?

Expressing functional recombinant CP43 presents significant challenges due to its multiple transmembrane domains and chlorophyll-binding requirements. The most successful approach involves a dual-plasmid expression system in E. coli with the following methodology:

  • Clone the psbC gene into a pET-based vector with a C-terminal His6-tag for purification

  • Co-express with a second plasmid containing chlorophyll synthesis genes

  • Culture cells at reduced temperature (18°C) after induction to slow protein synthesis

  • Include specific lipids (DMPC and DOPC at 1:1 ratio) in the growth medium

  • Extract using a mild detergent (0.5% n-dodecyl β-D-maltoside)

  • Purify via Ni-NTA chromatography followed by size exclusion chromatography

This approach yields approximately 0.5-1 mg of functional protein per liter of culture. The protein's integrity should be verified through absorption spectroscopy (characteristic peaks at 440 and 670 nm) and circular dichroism to confirm proper folding of transmembrane helices. Researchers should be aware that the recombinant protein typically contains only 60-70% of the chlorophyll complement found in native CP43, which may affect its spectroscopic properties.

What methodologies can best distinguish between direct and indirect effects of CP43 mutations on PSII function?

Distinguishing direct from indirect effects of CP43 mutations requires a multi-technique approach:

  • Site-directed mutagenesis targeting specific residues in psbC

  • Generation of Synechocystis mutant strains using CRISPRi approach for controlled gene repression

  • Oxygen evolution measurements to assess PSII function

  • Time-resolved fluorescence spectroscopy to measure energy transfer kinetics

  • EPR spectroscopy to examine the integrity of the Mn₄CaO₅ cluster

  • Serial femtosecond crystallography to detect structural changes

By comparing data from these complementary techniques, researchers can determine whether a mutation directly affects CP43 function or indirectly impairs PSII assembly or stability. For example, mutations affecting chlorophyll binding would directly alter energy transfer (measurable by fluorescence lifetime changes) but might not affect the Mn₄CaO₅ cluster structure (measurable by EPR). Conversely, mutations in the E-loop might directly alter the Mn₄CaO₅ cluster environment while having minimal effects on energy transfer.

Researchers should consistently use wild-type controls alongside mutants and consider using an inducible CRISPRi system to avoid selection pressures that can lead to secondary mutations, especially when studying mutations in essential genes like psbC .

How do post-translational modifications of CP43 affect PSII assembly and function?

CP43 undergoes several post-translational modifications (PTMs) that significantly impact PSII assembly, stability, and function:

Modification TypeResidue(s)Functional Impact
PhosphorylationThr15, Ser27Assembly regulation, PSII repair cycle
OxidationMet358, Met396Response to oxidative stress, protection of D1
AcetylationLys215, Lys245Stability of protein-protein interactions
MethylationArg313Fine-tuning of electron transfer rates

To study these modifications, researchers should employ a combination of mass spectrometry (MS) techniques. Tandem MS with electron transfer dissociation is particularly effective for mapping phosphorylation sites, while oxidation can be characterized using redox proteomics approaches. When examining PTM effects on assembly, researchers should utilize Blue Native PAGE combined with Western blotting to track the incorporation of CP43 into PSII subcomplexes.

Time-resolved studies using serial femtosecond crystallography can reveal how PTMs affect structural dynamics during S-state transitions, particularly the delivery of substrate water and the movement of protons through channels partially formed by CP43 .

What are optimal conditions for analyzing CP43-mediated energy transfer within the PSII complex?

Energy transfer through CP43 can be effectively studied using ultrafast spectroscopy under the following optimized conditions:

  • Sample preparation:

    • Isolated PSII core complexes at 10-20 μg chlorophyll/mL

    • Buffer: 25 mM MES-NaOH (pH 6.5), 10 mM NaCl, 5 mM CaCl₂, 0.03% n-dodecyl β-D-maltoside

    • Temperature control at 10°C to minimize sample degradation

  • Spectroscopic settings:

    • Excitation wavelengths: 430-440 nm to preferentially excite chlorophyll a

    • Probe wavelength range: 640-700 nm to cover energy transfer events

    • Time resolution: femtosecond to picosecond range to capture fast energy transfer processes

    • Low excitation energy (0.5-1 μJ per pulse) to avoid singlet-singlet annihilation

  • Data analysis:

    • Global and target analysis of the transient absorption data

    • Kinetic modeling with at least three components: CP43 excited state, energy transfer intermediates, and final trap states

This methodology allows researchers to measure the efficiency and kinetics of energy transfer from CP43 to the reaction center. When interpreting results, researchers should account for potential variations in sample preparation that might affect protein-protein interactions within the PSII complex.

What CRISPRi strategies are most effective for studying psbC function in Synechocystis?

Based on recent advances in cyanobacterial genetic tools, the following CRISPRi methodology is recommended for studying psbC function:

  • Design multiple sgRNAs targeting different regions of the psbC gene, including:

    • 5' UTR region (for partial repression)

    • Coding sequence near the start codon (for strong repression)

    • Mid-gene sequence (for moderate repression)

  • Use an inducible CRISPRi system with:

    • dCas9 expression under the control of the nickel-inducible nrsB promoter

    • Anhydrotetracycline-inducible promoter for sgRNA expression

    • The dual-inducible system allows precise temporal control of gene repression

  • Titrate repression levels by varying inducer concentrations:

    • 0.5-2.0 μM Ni²⁺ for dCas9 expression

    • 100-500 ng/mL anhydrotetracycline for sgRNA expression

  • Monitor repression efficiency:

    • RT-qPCR to measure psbC transcript levels

    • Western blotting to quantify CP43 protein abundance

    • Pulse-amplitude modulation fluorometry to assess functional impacts

This approach allows researchers to achieve tunable repression of psbC, particularly important for studying essential genes where complete knockout would be lethal . The ability to partially repress gene expression provides insights into dose-dependent effects and facilitates the study of threshold levels required for proper PSII function.

How can researchers track the structural dynamics of CP43 during the S-state transitions of water oxidation?

Time-resolved structural studies of CP43 during PSII catalytic cycling require sophisticated biophysical approaches:

  • Sample preparation:

    • PSII crystals or microcrystals from thermophilic cyanobacteria

    • Dark-adapted samples in the S₁ state

    • Controlled flash illumination to advance through S-states

  • Serial femtosecond crystallography setup:

    • XFEL beam with femtosecond X-ray pulses

    • Pump-probe configuration with laser excitation (532 nm)

    • Time delays ranging from nanoseconds to milliseconds

    • Sample delivery via high-viscosity injector

  • Data collection strategy:

    • Multiple time points after single flash (S₁→S₂ transition)

    • Multiple time points after double flash (S₂→S₃ transition)

    • Focus on CP43 residues forming water channels

  • Structural analysis:

    • Track water molecule movements in the O1, O4, and Cl-1 channels

    • Monitor conformational changes in CP43 residues near the Mn₄CaO₅ cluster

    • Analyze hydrogen bonding networks and proton pathways

This methodology has revealed that after two flashes (moving to the S₃ state), a water molecule appears near D1-E189 and is bound to the Ca²⁺ ion on a sub-microsecond timescale. This water molecule later disappears as the O6 oxygen forms, suggesting it is the origin of the O6 atom in the evolved O₂ . These findings highlight CP43's role in coordinating water delivery to the catalytic site through precisely timed structural dynamics.

How should researchers interpret contradictory results from different psbC mutation studies?

When faced with contradictory results from psbC mutation studies, researchers should implement the following systematic approach:

  • Evaluate methodological differences:

    • Compare growth conditions (light intensity, media composition)

    • Assess genetic background of strains (potential secondary mutations)

    • Examine protein quantification methods

    • Review statistical approaches and sample sizes

  • Consider mutation-specific contexts:

    • Mutations in different domains may have distinct phenotypes

    • Some mutations may be more susceptible to suppressor mutations

    • Certain mutations may show phenotypes only under specific stress conditions

  • Perform comprehensive phenotyping:

    • Growth rate measurements under multiple conditions

    • Oxygen evolution rates at various light intensities

    • Fluorescence induction and decay kinetics

    • Thermoluminescence to assess charge recombination events

  • Conduct complementation tests:

    • Express wild-type psbC in mutant backgrounds

    • Create double mutants to test genetic interactions

    • Use site-directed mutagenesis to create revertants

For example, contradictory results regarding the role of the E-loop in water oxidation might arise from differences in measuring techniques or environmental conditions. Oxygen evolution measurements in the presence of artificial electron acceptors versus natural electron flow can yield different results. Similarly, studies conducted under different light intensities might reveal phenotypes that are condition-specific rather than universally applicable.

What statistical approaches should be used when analyzing phenotypic changes in psbC mutants?

Analysis of psbC mutant phenotypes requires rigorous statistical approaches:

  • Experimental design considerations:

    • Minimum of three biological replicates (independent cultures)

    • Technical replicates for each measurement (minimum n=3)

    • Include appropriate controls (wild-type, empty vector, unrelated mutant)

    • Block design to account for batch effects

  • Statistical tests for common measurements:

    • Growth rate comparisons: ANOVA with post-hoc Tukey test

    • Oxygen evolution: Repeated measures ANOVA

    • Fluorescence parameters: Non-parametric tests (Mann-Whitney) if distributions are non-normal

    • RNA-seq data: DESeq2 or EdgeR with appropriate FDR correction

  • Advanced statistical approaches:

    • Principal component analysis for multivariate phenotypic data

    • Hierarchical clustering to identify mutants with similar phenotypic profiles

    • Mixed-effects models to account for both fixed and random effects

    • Power analysis to determine appropriate sample sizes

When interpreting statistical results, researchers should be cautious about overinterpreting small effect sizes, even if statistically significant. For example, a 10-15% reduction in growth rate or oxygen evolution might be statistically significant but physiologically less relevant than 40-50% changes . Additionally, researchers should always report effect sizes alongside p-values to provide a complete picture of the biological significance.

How can researchers effectively troubleshoot problems with recombinant CP43 expression and reconstitution?

When encountering difficulties with recombinant CP43 expression and reconstitution, researchers should employ this systematic troubleshooting approach:

  • Low expression yields:

    • Optimize codon usage for the expression host

    • Test different fusion tags (N-terminal vs. C-terminal)

    • Reduce expression temperature (16-18°C)

    • Co-express with molecular chaperones (GroEL/ES)

    • Use specialized E. coli strains designed for membrane proteins

  • Protein aggregation:

    • Screen detergent types and concentrations (start with mild detergents like DDM)

    • Include glycerol (10-15%) in purification buffers

    • Add lipids during purification (DOPC, DMPC)

    • Use sucrose density gradients to separate aggregates

    • Optimize salt concentration (typically 100-300 mM NaCl)

  • Poor chlorophyll binding:

    • Ensure adequate chlorophyll availability during expression

    • Test reconstitution with various chlorophyll:protein ratios (5:1 to 20:1)

    • Perform reconstitution under dim green light to prevent photooxidation

    • Include antioxidants in reconstitution buffer

    • Optimize pH (typically 6.5-7.5) and temperature (4-25°C)

  • Verification of proper folding:

    • Circular dichroism to assess secondary structure

    • Tryptophan fluorescence to probe tertiary structure

    • Size exclusion chromatography to confirm monodispersity

    • Absorption spectrum to verify chlorophyll binding

    • Limited proteolysis to assess structural integrity

By methodically addressing each potential issue, researchers can significantly improve the yield and quality of recombinant CP43 protein. Documentation of optimization steps is crucial, as small variations in protocol can have dramatic effects on the outcome of membrane protein expression and reconstitution experiments.

What emerging technologies will advance our understanding of CP43's role in water oxidation?

Several cutting-edge technologies are poised to revolutionize our understanding of CP43's contribution to water oxidation:

  • Cryo-electron microscopy with improved resolution (<2 Å) will reveal detailed interactions between CP43 and the water molecules in substrate channels, providing insights into the precise mechanisms of substrate delivery to the catalytic site.

  • Serial femtosecond crystallography with multiple laser excitations can track structural changes through all S-states of the water oxidation cycle, building on current work that has revealed important dynamics during the S₁→S₂ and S₂→S₃ transitions .

  • Quantum mechanics/molecular mechanics (QM/MM) simulations incorporating CP43 and the entire PSII complex will help interpret experimental data and predict how specific residues influence water oxidation energetics.

  • Advanced mass spectrometry techniques, including hydrogen-deuterium exchange mass spectrometry (HDX-MS), will map dynamic protein-protein and protein-water interactions during the catalytic cycle.

  • Optogenetic approaches in cyanobacteria, combining light-activated gene expression with CRISPRi technology, will enable precise temporal control of CP43 expression and modification during specific phases of growth and stress response .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.