Recombinant Synechocystis sp. Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Synechocystis sp. Photosystem II CP47 Chlorophyll Apoprotein (psbB)

The CP47 protein (psbB) is a core antenna subunit of Photosystem II (PSII) in cyanobacteria like Synechocystis sp. PCC 6803. It binds chlorophyll a and β-carotene, serving as a structural and functional anchor for light harvesting and stabilization of the PSII reaction center. Recombinant versions of this protein, often engineered with tags (e.g., His-tag) for purification, are critical tools for studying PSII assembly, biogenesis, and chlorophyll dynamics.

Role in Photosystem II Assembly

CP47 is indispensable for PSII core complex formation. It binds to the D1/D2 heterodimer early in assembly, forming the reaction center assembly complex (RCII) before CP43 attachment . Mutants lacking CP47 show:

  • Accumulation of unassembled D1 precursor

  • Impaired RCII formation

  • Reduced chlorophyll levels

Biogenesis and Assembly Pathway

CP47 biogenesis involves coordinated interactions with assembly factors:

Key Players

ProteinRoleSource
CyanoPBinds D2 in early RCII stages; facilitates CP47 integration into PSII
Pam68Stabilizes nascent CP47 during chlorophyll insertion; interacts with ribosomes near SecY
PsbHStabilizes stromal loops of CP47; critical for chlorophyll binding

Assembly Stages

  1. RCII formation: D1/D2 + cytochrome b559 + CP47

  2. CP43 integration: Forms the PSII core complex

  3. Chlorophyll loading: Requires Pam68 and PsbH

Half-Lives of PSII Components

ComponentHalf-Life (h)StrainImpactSource
CP47 (PsbB)15 ± 1PSI-lessStable in core complexes
D1 (PsbA)1.5 ± 0.5PSI-lessRapid turnover due to photodamage
Chlorophyll40 ± 2PSI-lessReduced by 50% in SCP-less mutants

Mutant Observations

MutantPhenotypeSource
ΔCP47Accumulates D1 precursor; impaired RCII formation
ΔCP47 + ferrochelatase inhibitionRestored CP47 accumulation and PSII assembly
Δpam68Defective CP47 chlorophyll insertion; reduced PSII assembly

Recombinant Production and Applications

While commercial recombinant CP47 from Synechocystis is not widely documented, His-tagged versions are used in research:

  • Expression systems: Synechocystis itself (e.g., CP47-His strains for nickel-affinity purification) .

  • Applications:

    • Purification of RCII complexes

    • Study of chlorophyll-protein interactions

    • Bioengineering of PSII assembly pathways

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
psbB; slr0906; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-507
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLISVHLMHTALVAGWAGSMALYELAIFDSSDAVLNPMWRQGM FVLPFMARLGVTSSWNGWSVTGETGLDPGFWSFEGVAAAHIVLSGLLFLAAVWHWVFWDL ELFVDPRTGESALDLPKMFGIHLFLSGLLCFGFGAFHLTGVWGPGMWVSDPYGLTGHVQP VAPEWGPAGFNPFNPGGVVAHHIAAGIVGIIAGLFHLTVRPPERLYKALRMGNIETVLSS SIAAVFFAAFVVAGTMWYGNATTPIELFGPTRYQWDKGYFQEEIQRRVDSQLAEGASLSE AWSTIPEKLAFYDYVGNSPAKGGLFRTGAMNSGDGIAQEWIGHPIFKDKEGRELEVRRMP NFFETFPVIMTDADGVVRADIPFRRSESKFSVEQTGVTVSFYGGALDGQTFSNPSDVKKF ARKAQLGEGFDFDTETFNSDGVFRTSPRGWFTFGHAVFALLFFFGHIWHGSRTLFRDVFA GVDPGLEEQVEFGVFAKVGDLSTRKEA
Uniprot No.

Target Background

Function

A core component of the Photosystem II (PSII) complex, this chlorophyll-binding protein facilitates the primary light-driven photochemical reactions of PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently used for ATP synthesis.

Database Links
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the CP47 protein and what is its role in photosystem II?

CP47, encoded by the psbB gene, is a core antenna protein of photosystem II (PSII) that plays a crucial role in light harvesting and energy transfer to the reaction center. Structurally, CP47 contains six transmembrane α-helices and binds 16 chlorophyll a molecules and β-carotene in cyanobacterial PSII holoenzymes . It is positioned adjacent to the heterodimeric D1/D2 reaction center complex, functioning as an inner light-harvesting antenna system to capture and funnel light energy toward the P680 reaction center . During PSII biogenesis, CP47 joins the reaction center (RC) complex after formation of the D1/D2 heterodimer, with assistance from the assembly factor Psb28, to form the RC47 complex . This step is critical for subsequent assembly processes, including the attachment of CP43 and activation of water-splitting capabilities.

How does CP47 differ structurally and functionally from CP43?

While both CP47 and CP43 serve as core antenna proteins in PSII, they differ in several significant ways:

FeatureCP47CP43
GenepsbBpsbC
Chlorophyll content16 Chl a molecules13 Chl a molecules
Assembly timingJoins RC complex firstAttaches after CP47
Associated small subunitsPsbH, PsbL, PsbTPsbK, Psb30/Ycf12
Additional functionsInner antennaInner antenna + ligates Mn₄Ca cluster
PositionOne side of RCOpposite side of RC from CP47

CP43 has an additional role in ligating the Mn₄Ca cluster essential for water oxidation, while CP47 does not directly participate in this function . During PSII assembly, CP47 attaches to the reaction center complex before CP43, establishing a directional assembly process .

What are the most effective strategies for expressing and purifying recombinant CP47 from Synechocystis sp. PCC 6803?

The most effective approach for isolating CP47 from Synechocystis sp. PCC 6803 involves a combination of genetic engineering and strategic purification steps:

  • His-tagging strategy: Introduce a His₆-tag at the C-terminus of the psbB gene (encoding CP47) through homologous recombination .

  • PSII assembly interruption: Transform the His-tag construct into a D1 deletion mutant (ΔD1) background, which blocks PSII assembly at an early stage, preventing CP47 from being incorporated into larger complexes .

  • Protease protection: Additionally inactivate the FtsH2 protease (creating a ΔD1/ΔFtsH2 strain) to prevent degradation of unassembled PSII proteins, which significantly improves yield .

  • Affinity purification: Use nickel affinity chromatography to isolate the His-tagged CP47 protein.

  • Further purification: Apply additional chromatographic steps (ion exchange, size exclusion) to achieve higher purity if needed.

This approach allows isolation of CP47 with its naturally bound pigments and associated small subunits (PsbH, PsbL, and PsbT), providing material suitable for structural and functional studies .

How can researchers verify the proper folding and pigment binding of recombinant CP47?

Verification of proper folding and pigment binding for recombinant CP47 requires several complementary spectroscopic and analytical approaches:

  • Absorption spectroscopy: Properly folded CP47 should show characteristic absorption peaks in the visible region (400-700 nm), particularly in the Q<sub>y</sub> region (~675-680 nm), indicating chlorophyll a binding .

  • Low-temperature (77K) fluorescence spectroscopy: CP47-His isolated from Synechocystis should exhibit a fluorescence emission maximum around 683-685 nm (shifted slightly from the 686 nm observed in CP47 isolated from spinach) .

  • Pigment analysis: HPLC analysis should confirm the presence of chlorophyll a and β-carotene in appropriate ratios .

  • Co-purification analysis: Immunoblotting and mass spectrometry should detect the presence of associated small subunits (PsbH, PsbL, and PsbT) .

  • Circular dichroism: Can provide information about secondary structure elements.

  • Fluorescence quantum yield measurements: Can assess the efficiency of energy transfer within the protein complex.

Discrepancies in these measurements compared to reference standards may indicate improper folding or incomplete pigment binding.

How can recombinant CP47 be used to study PSII assembly mechanisms?

Recombinant CP47 serves as a powerful tool for investigating PSII assembly through several research approaches:

  • Intermediate complex characterization: Isolated CP47 and CP47-containing subcomplexes (like RC47) enable detailed analysis of assembly intermediates that are normally present at low abundance in cells .

  • Interaction studies: Using tagged CP47, researchers can perform pull-down assays to identify proteins that interact with CP47 during different assembly stages. This approach revealed that CP47 associates with PsbH, PsbL, and PsbT before incorporation into PSII .

  • Mutational analysis: Targeted mutations in CP47 can identify regions critical for interaction with assembly factors (like Psb28) and other PSII subunits .

  • Assembly factor studies: Recombinant CP47 can be used in reconstitution experiments with purified assembly factors (like Psb28) to elucidate their specific roles in facilitating proper CP47 incorporation into PSII .

  • Time-resolved assembly monitoring: By combining recombinant CP47 with other PSII components in vitro, researchers can monitor the assembly process in real-time using spectroscopic techniques.

These approaches have revealed that CP47 forms preassembled pigment-protein complexes before incorporation into PSII and that its proper assembly is facilitated by specific assembly factors like Psb28 .

What experimental designs can be used to investigate the interaction between CP47 and assembly factors like Psb28?

Several experimental approaches can elucidate the interactions between CP47 and assembly factors:

  • Nuclear Magnetic Resonance (NMR) spectroscopy: Chemical shift perturbation (CSP) experiments using recombinant Psb28 and synthetic peptides of the conserved CP47 C-terminus can characterize this interaction in detail and determine dissociation constants .

  • Cryo-electron microscopy (cryo-EM): Single-particle analysis of PSII assembly intermediates can reveal the precise binding position of Psb28 to CP47 and associated conformational changes. This approach showed that Psb28 binds near the Q<sub>B</sub> binding site (not at the position previously predicted by mass spectrometry) .

  • Co-immunoprecipitation with mass spectrometry: Using tagged versions of either CP47 or Psb28 to pull down interaction partners and identify them by mass spectrometry.

  • FRET-based interaction assays: Fluorescently labeled CP47 and Psb28 can be used to monitor their interaction dynamics in real-time.

  • Molecular dynamics simulations: Computational approaches can model the interaction interface and predict the effects of mutations.

Integrating these methods has revealed that Psb28 binding induces the formation of an extended β-hairpin structure incorporating the central antiparallel β-sheet of Psb28, the C-terminus of CP47, and the D1 D-E loop .

How do mutations in the CP47 protein affect chlorophyll binding and PSII assembly?

Mutations in CP47 can significantly impact chlorophyll binding and PSII assembly through several mechanisms:

The interplay between mutation effects and chlorophyll metabolism is particularly significant, as demonstrated by the finding that supplementation with chlorophyll precursor Mg-protoporphyrin IX increased the number of active PSII centers in a CP47 mutant . This suggests that enhancing chlorophyll availability can partially rescue defects in CP47 protein expression or stability.

What is the role of the CP47 C-terminus in PSII assembly and how does it interact with assembly factors?

The C-terminus of CP47 plays a crucial role in PSII assembly through specific interactions with assembly factors:

  • Psb28 binding site: The C-terminus of CP47 forms part of the binding site for the assembly factor Psb28. This interaction involves the formation of an extended β-hairpin structure that incorporates the central antiparallel β-sheet of Psb28, the C-terminus of CP47, and the D1 D-E loop .

  • Directionality of assembly: The interaction between the CP47 C-terminus and Psb28 imparts directionality to the PSII assembly process. In the mature PSII complex (without Psb28), the CP47 C-terminus blocks the Psb28 binding site by interacting with the D1 D-E loop, preventing the reverse process and protecting active PSII from perturbation by Psb28 .

  • Conformational changes: Binding of Psb28 to the CP47 C-terminus induces conformational changes at the PSII acceptor side, distorting the binding pocket of the mobile quinone (Q<sub>B</sub>) and replacing the bicarbonate ligand of non-haem iron with glutamate .

  • Regulatory transitions: The CP47 C-terminus appears to participate in conformational changes that occur during the transition from the assembly intermediate to the mature complex, particularly affecting the positioning of CP43 when it attaches to the RC47 complex .

Nuclear magnetic resonance (NMR) spectroscopy experiments using synthetic peptides of the conserved CP47 C-terminus have helped characterize these interactions in detail and determine the binding affinity to assembly factors .

What are the main challenges in studying CP47 outside of its native PSII complex and how can they be addressed?

Studying isolated CP47 presents several significant challenges:

ChallengeManifestationSolution Approaches
Low abundanceDifficulty obtaining sufficient materialUse D1 deletion backgrounds to block assembly and accumulate CP47
Protein instabilityDegradation during purificationInactivate FtsH2 protease; optimize buffer conditions
Pigment lossLoss of chlorophyll during isolationGentle purification methods; avoid harsh detergents
Improper foldingNon-native spectroscopic propertiesCompare with control spectra; optimize expression conditions
AggregationFormation of non-functional aggregatesScreen detergents; use amphipols or nanodiscs
Lack of assembly factorsMissing native interactionsCo-express with assembly factors like Psb28

The most successful approach has been a combination of genetic engineering (His-tagging, using assembly-blocked backgrounds, and protease inactivation) along with careful optimization of purification conditions . This strategy allows isolation of CP47 with its naturally bound pigments and associated small subunits, making it suitable for detailed structural and functional studies.

How can researchers distinguish between properly assembled CP47-pigment complexes and misfolded or aggregated protein?

Distinguishing properly assembled CP47-pigment complexes from misfolded/aggregated protein requires multiple analytical approaches:

  • Absorption spectroscopy: Properly folded CP47 shows characteristic chlorophyll absorption peaks with appropriate ratios and positions. The properly folded complex has distinct absorption features in the Q<sub>y</sub> region (675-680 nm) .

  • Fluorescence emission spectra: At low temperature (77K), properly folded CP47-His from Synechocystis sp. PCC 6803 exhibits a fluorescence emission maximum around 683-685 nm, with a 1-3 nm blue shift compared to CP47 isolated from spinach PSII .

  • Fluorescence quantum yield: The quantum yield of fluorescence is characteristically lower for properly folded CP47 from Synechocystis compared to that isolated by fragmentation of spinach PSII core complexes .

  • Size exclusion chromatography: This can separate properly folded monomeric complexes from aggregates.

  • Native gel electrophoresis: Can distinguish between different oligomeric states and aggregated material.

  • Co-purification of expected subunits: Properly folded CP47 should co-purify with specific small subunits (PsbH, PsbL, and PsbT) that can be detected by immunoblotting or mass spectrometry .

  • Pigment analysis: HPLC analysis should confirm the expected chlorophyll a to β-carotene ratio characteristic of properly folded CP47.

Researchers should use these methods in combination rather than relying on a single technique to definitively determine the quality of their purified CP47 complexes.

How might the structural insights from recombinant CP47 studies contribute to engineering improved photosynthetic efficiency?

Structural studies of recombinant CP47 offer several promising avenues for engineering enhanced photosynthetic efficiency:

  • Optimization of light harvesting: Understanding the precise arrangement of chlorophyll molecules in CP47 could enable engineering of modified versions with expanded spectral absorption or improved energy transfer efficiency .

  • Enhanced PSII assembly: Knowledge of how assembly factors like Psb28 interact with CP47 could inform strategies to accelerate or optimize PSII assembly, potentially increasing the rate of functional PSII formation .

  • Improved stress resistance: The protective role of assembly factors in shielding PSII assembly intermediates from photodamage suggests potential approaches for engineering more stress-resistant photosystems. Understanding how Psb28 blocks electron transport to protect RC47 complexes could inspire strategies to reduce photodamage under high light conditions .

  • Regulation of chlorophyll biosynthesis: Insights from CP47 mutant studies showing how increased chlorophyll availability can enhance CP47 accumulation and PSII assembly could lead to approaches for coordinating chlorophyll synthesis with protein expression to optimize assembly .

  • Novel design principles: The β-hairpin structure formed by the interaction between Psb28 and the CP47 C-terminus demonstrates how protein-protein interactions can be engineered to induce protective conformational changes in electron transport components .

Implementing these insights could contribute to developing crop plants or algae with improved photosynthetic efficiency, particularly under variable or stressful environmental conditions.

What are the implications of Psb34 discovery for understanding PSII biogenesis and potential biotechnological applications?

The recent discovery of Psb34 as a previously unidentified assembly factor has significant implications:

Further research into the precise molecular function of Psb34 will likely reveal additional opportunities for biotechnological applications related to optimizing photosynthesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.