Recombinant Synechocystis sp. Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Definition and Production of Recombinant Synechocystis sp. Photosystem Q(B) Protein

The recombinant Photosystem Q(B) protein (UniProt ID: P16033) is a full-length, His-tagged variant of the PSII D1 protein from Synechocystis sp. PCC 6803, expressed in E. coli. This protein spans 344 amino acids and is critical for photosynthetic electron transfer in the Photosystem II (PSII) complex, where it binds the secondary quinone acceptor Q(B) and participates in the water-splitting process .

ParameterValue
Gene NamepsbA2
SynonymspsbA-2, slr1311, Photosystem II Q(B) protein 2
Expression SystemE. coli
TagN-terminal His tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol

The protein’s amino acid sequence includes hydrophobic transmembrane domains critical for integration into the thylakoid membrane and interaction with the Mn₄CaO₅ cluster .

Functional Role in Photosystem II

The Q(B) protein (D1) is essential for stabilizing the PSII reaction center and facilitating electron transfer from Q(A) to Q(B). Mutations or truncations in this protein disrupt PSII assembly, leading to photoinhibition and altered redox potentials of quinones .

Key Functional Insights

  1. Charge Separation and Stability

    • The PsbP-like protein (Sll1418) stabilizes charge separation in PSII by interacting with the Mn cluster, but its absence increases miss probabilities in oxygen evolution and shifts S-state recombination patterns .

    • Truncation of Slr2013 (a chaperone) in Synechocystis restores photoautotrophic growth in T192H mutants by improving D2 protein folding, indirectly highlighting the interdependence of Q(B) and D2 in PSII assembly .

  2. Redox Potential Modulation

    • Mutants with altered Q(B) or D1 integration (e.g., slr1471-gfp) exhibit decreased Q(B)− redox potential (e.g., thermoluminescence B-band maxima shifting from 34.2°C to 31.3°C), impairing electron transfer efficiency .

ParameterWild TypeMutant (slr1471-gfp)Source
Q(B)− Redox Potential34.2°C31.3°C
PSII StabilityHighReduced (photoinhibition)

Research Applications and Methodologies

The recombinant Q(B) protein is used in structural and functional studies of PSII, including:

ApplicationMethodologyOutcome
Structural AnalysisSDS-PAGE, circular dichroism (CD), NMR spectroscopy>90% purity confirmed; 34–38% α-helical structure in PsbH (homologous protein)
Electron Transfer StudiesThermoluminescence, flash-induced oxygen evolution, S-state recombinationAltered S(3)Q(B)− vs. S(2)Q(B)− recombination in PsbP-like mutants
Assembly and ChaperonesComplementation assays, GFP tagging, mass spectrometrySlr2013 truncation restores PSII function in T192H mutants ; Slr1471p interacts with D1

Challenges and Future Directions

  1. Protein Stability

    • Repeated freeze-thaw cycles degrade the recombinant protein, necessitating aliquoting and storage at −20°C/-80°C .

  2. Functional Reconstitution

    • While the His-tagged variant facilitates purification, in vitro reconstitution of PSII cores requires additional subunits (e.g., CP47, D2) and cofactors (e.g., Mn, Ca) .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; psbA-I; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6714) (Aphanocapsa sp. (strain PCC 6714))
Target Names
psbA
Target Protein Sequence
MTTTLQQRESASLWEQFCQWVTSTNNRIYVGWFGTLMIPTLLTATTCFIIAFIAAPPVDI DGIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVVFQFL IGIFCYMGRQWELSYRLGMRPWICVAYSAPVSARTAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEVESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVIGIWFTAMGVSTMAFNLNGF NFNQSILDSQGRVIGTWADVLNRANIGFEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q (B) protein in Synechocystis sp.?

The Photosystem Q (B) protein, also known as the D1 protein, is a 32 kDa thylakoid membrane protein encoded by the psbA gene in Synechocystis sp. PCC 6803 . It serves as a core component of the Photosystem II (PSII) reaction center, binding the secondary plastoquinone electron acceptor QB and playing a crucial role in the photosynthetic electron transport chain. The protein contains multiple transmembrane domains and forms part of the heterodimeric core of PSII along with the D2 protein, where water-splitting and electron transport occur . The full-length protein has a molecular weight of approximately 39.8 kDa .

How many copies of the psbA gene are present in Synechocystis sp. PCC 6803?

Synechocystis sp. PCC 6803 contains three copies of the psbA gene (psbA1, psbA2, and psbA3), all encoding the D1 reaction center protein of Photosystem II . Of these, psbA2 is constitutively expressed under normal growth conditions, while the expression of psbA1 and psbA3 occurs primarily under specific stress conditions . This genetic redundancy provides adaptive flexibility, allowing the organism to optimize photosynthetic function under varying environmental conditions.

What are the key structural features of the D1 protein important for function?

The D1 protein contains several key structural features critical for its function:

  • Multiple transmembrane helices that anchor the protein in the thylakoid membrane

  • Binding sites for various cofactors including chlorophyll, pheophytin, and quinones

  • A QB binding pocket that accommodates the secondary plastoquinone electron acceptor

  • Specific amino acid residues such as D1-Glu244, which participates in a hydrogen-bond network required for protonation of QB

  • Tyrosine residues like Y112 that play important roles in electron transfer processes and protein stability

  • Conserved regions that interact with other PSII subunits and assembly factors

These structural elements collectively enable the D1 protein to function effectively in electron transport during photosynthesis, particularly in transferring electrons from the primary quinone acceptor QA to the secondary quinone acceptor QB .

What mutagenesis systems are available for targeted modification of the psbA2 gene?

An improved mutagenesis system has been developed for targeted modification of the psbA2 gene in Synechocystis sp. PCC 6803. This system involves:

  • Construction of a triple deletion strain where:

    • psbA1 and psbA3 are removed by markerless deletions

    • psbA2 is replaced by a chloramphenicol-resistance cassette

  • Design of a vector that enables:

    • Reintroduction of a modified psbA2 gene into the chromosome

    • Use of a kanamycin-resistance cassette as a selectable marker

    • Preventing effects on the expression of flanking genes

This system has been successfully employed to generate control strains with unmodified psbA2 and mutant strains with specific amino acid substitutions, such as the mutation of D1-Glu244 to His or Asp . The approach allows for precise analysis of how specific residues contribute to D1 protein function without interference from other psbA gene copies.

How do mutations in D1-Glu244 affect electron transfer between QA and QB?

Mutations of the D1-Glu244 residue have significant effects on electron transfer between the primary quinone acceptor QA and the secondary quinone acceptor QB in Photosystem II:

  • The D1-Glu244 residue participates in a hydrogen-bond network required for protonation of QB

  • When Glu244 is substituted with histidine (E244H):

    • Oxygen evolution is impaired

    • Electron transfer between QA and QB is altered

    • The phenotype shows significant deviation from wild-type characteristics

  • When Glu244 is substituted with aspartic acid (E244D):

    • The resulting mutant more closely resembles the control strain

    • This suggests that maintaining an acidic residue at this position is important for proper function

These findings highlight the critical role of D1-Glu244 in facilitating electron transfer and maintaining the appropriate redox environment in the QB binding pocket, which is essential for efficient photosynthetic function.

What is the impact of the Y112L mutation on Photosystem II activity?

The Y112L mutation in the psbA gene has profound effects on Photosystem II activity and D1 protein turnover:

  • PSII activity is undetectable when Y112L mutants are grown at normal light intensities (30 μmol photons m-2 s-1)

  • Low levels of D1 and D2 proteins and minimal oxygen evolution activity are observed only when mutant cells are grown under very low light intensity (0.5-1 μmol m-2 s-1)

  • Thermoluminescence measurements reveal altered recombination of the QB-/S2,3 states:

    • The thermoluminescence signal emission maximum occurs at 20°C in Y112L mutants compared to 35-40°C in wild-type cells

    • This indicates a possible change in the S2,3/Yz equilibrium

  • The Y112L mutant cells exhibit rapid photoinactivation and impaired recovery of PSII activity

These results suggest that replacing the aromatic tyrosine residue at position Y112 with a hydrophobic leucine significantly alters donor-side electron transport activity and affects both the degradation and replacement of PSII core proteins, highlighting the importance of this residue for proper PSII function.

How does Slr1471p interact with the D1 protein during membrane integration?

Slr1471p, an Oxa1p/Alb3/YidC homolog in Synechocystis sp. PCC 6803, plays a crucial role in the membrane integration of the D1 protein:

  • Direct interaction between Slr1471p and the D1 protein has been demonstrated experimentally

  • When Slr1471p function is impaired (as in the slr1471-gfp mutant):

    • Membrane integration of the D1 precursor protein (pD1) is affected

    • pD1 accumulates in the membrane phase

    • pD1 accumulates in two reaction center assembly intermediates

  • Photoinhibition in slr1471-gfp mutants correlates with altered redox properties:

    • Increased redox potential of the reaction center quinone QA-

    • Decreased redox potential of QB-

These findings indicate that Slr1471p is essential for the proper integration of the D1 protein into the thylakoid membrane during the de novo assembly of the PSII reaction center. Defects in this process can lead to alterations in the redox properties of the reaction center quinones and ultimately result in photoinhibition.

How can thermoluminescence measurements assess charge recombination in PSII mutants?

Thermoluminescence (TL) measurements provide valuable insights into charge recombination processes in Photosystem II mutants:

TL BandTemperature RangeCharge Recombination SourceInterpretation of Shifts
B-band~34-40°CS2,3+QAQB-Lower temp: decreased QB- redox potential
Q-band~8-10°CS2+QA-Higher temp: increased QA- redox potential
C-band~47°CAlternative pathwaysIndicates structural changes

In experimental applications:

  • In wild-type and control cells, the B-band emission maximum occurs at approximately 34.2°C, indicating normal redox potential for QB-

  • In slr1471-gfp mutants, the B-band maximum shifts to 31.3°C, indicating a decreased redox potential for QB-

  • The Q-band emission maximum shifts from 8.0°C in wild-type to 15.7°C in slr1471-gfp mutants, indicating an increased redox potential of QA-

Similarly, the Y112L mutation causes the thermoluminescence signal emission maximum to occur at 20°C compared to 35-40°C in wild-type cells, suggesting alterations in the S2,3/Yz equilibrium .

These thermoluminescence measurements allow researchers to detect subtle changes in the energetics of electron transfer within PSII that may not be apparent through other techniques.

What is the relationship between redox potentials and photoinhibition in Synechocystis mutants?

The relationship between the redox potentials of quinone acceptors and photoinhibition in Synechocystis mutants is complex and bidirectional:

  • Altered redox potentials of QA- and QB- can lead to increased photoinhibition:

    • An increased redox potential of QA- (as observed in slr1471-gfp mutants) makes electron transfer to QB more difficult

    • A decreased redox potential of QB- reduces the stability of reduced QB, potentially disrupting forward electron flow

  • These changes disrupt normal electron transport, leading to:

    • Increased back-reactions in PSII

    • Enhanced production of reactive oxygen species

    • Accelerated damage to the D1 protein

  • In the slr1471-gfp mutant:

    • Photochemical inhibition occurs at light intensities above 80 μmol·m-2·s-1

    • This correlates directly with the altered redox potentials of QA- and QB-

    • Selective reduction in pigment content (particularly carotenoids and phycobilins) further increases susceptibility to photodamage

  • In the Y112L mutant, alterations in the S2,3/Yz equilibrium contribute to photoinhibition through disrupted donor-side electron transport

What methodological approaches are most effective for studying D1 protein turnover?

Several methodological approaches are particularly effective for studying D1 protein turnover in Synechocystis sp.:

  • Pulse-Chase Experiments:

    • Label proteins with radioactive amino acids during a short pulse

    • Chase with unlabeled amino acids under different light conditions

    • Sample at intervals to analyze D1 degradation and synthesis rates

    • This approach allows for direct measurement of protein turnover kinetics

  • Immunoblot Analysis:

    • Expose cultures to different light intensities (e.g., 0.5-1, 30, 80+ μmol·m-2·s-1)

    • Sample cells at regular intervals

    • Analyze D1 protein levels by western blotting with specific antibodies

    • This method is particularly valuable for comparing wild-type and mutant strains

  • Inhibitor-Based Approaches:

    • Use protein synthesis inhibitors (e.g., lincomycin)

    • Monitor D1 degradation in the absence of new synthesis

    • Calculate net turnover rates by comparison with uninhibited controls

  • Fluorescence-Based Measurements:

    • Monitor PSII activity using chlorophyll fluorescence

    • Correlate changes in fluorescence parameters with D1 turnover

    • This non-invasive approach allows for real-time monitoring

Combining these approaches provides comprehensive insights into how mutations affect D1 protein stability, degradation, and replacement under various environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.