Recombinant Synechocystis sp. Photosystem Q (B) protein 1

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Synechocystis sp. Photosystem Q(B) Protein 1

Recombinant Synechocystis sp. Photosystem Q(B) protein 1 is a genetically engineered variant of the D1 protein (PsbA), a core component of Photosystem II (PSII) in cyanobacteria. It plays a pivotal role in light-driven water oxidation and electron transfer processes. This protein binds the secondary quinone acceptor Q(B) in the PSII reaction center, facilitating charge separation and stabilizing the electron transport chain. Recombinant production involves expressing the His-tagged protein in E. coli for structural and functional studies .

Functional Role in Photosynthesis

The Q(B)-binding D1 protein is essential for:

  1. Electron Transfer: Facilitates sequential transfer of electrons from Q(A) to Q(B) in the PSII reaction center .

  2. Membrane Integration: Interacts with Slr1471p (Oxa1 homolog) to ensure proper membrane insertion of the D1 precursor (pD1), preventing photoinhibition .

  3. Stress Response: Gene expression (psbA) is dynamically regulated under UV-B light and high-intensity white light, balancing D1 synthesis and degradation via proteases like FtsH .

Redox Potential and Photoinhibition

Mutants with GFP-tagged Slr1471p exhibit altered redox potentials for Q(A) and Q(B), leading to:

  • Increased Q(A)− redox potential (impaired electron transfer).

  • Decreased Q(B)− redox potential, causing D1 precursor accumulation and PSII photoinhibition .

Gene Expression Under Stress

ConditionImpact on psbA ExpressionFunctional Consequence
UV-B lightDownregulatedReduced PSII activity; D1 turnover
High white lightCoordinated with FtsH proteaseBalanced D1 synthesis/degradation
Nitrogen deficiencyUpregulated in PHA-producing strainsEnhanced photosynthetic efficiency

Mutational Studies

  • Critical Residues:

    • F647: Aromatic residues are required for structural integrity .

    • G650: Small residues (e.g., glycine) stabilize the PSII complex .

Applications in Biotechnology

Recombinant D1 proteins are leveraged in:

  1. PHA Production: Overexpression in Synechocystis strains enhances photosynthetic flux, enabling efficient polyhydroxyalkanoate (PHA) biosynthesis .

  2. Protein Engineering: His-tagged variants enable purification for structural studies (e.g., crystallography) and functional assays .

  3. Stress-Tolerance Research: Mutant strains reveal mechanisms of light-induced damage and repair in PSII .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA1; psbA-1; slr1181; Photosystem II protein D1 1; PSII D1 protein 1; Photosystem II Q(B protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
psbA1
Target Protein Sequence
MTTTQLGLQEQSLWSRFCCWITSTSNRLYIGWFGVLMIPTLLTATTCFIIAFIAAPPVDI DGIREPIAGSLLYGNNIITAAVVPSSNAIGLHFYPIWEAHSLDEWLYNGGPYQLIVFHFL IGIFCYLGRQWELSYRLGMRPWICVAYSAPVAAATATLLIYSIGQGSFSDGLPLGISGTF NFMLVLQAEHNVLMHPFHMLGVAGVFGGALFAAMHGSLVTSSLIRETTEVESQNQGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLGAWPVVGIWFAALAVCCFAFNLNGF NFNQSILDAQGRPVSTWADVINRANIGFEVMHERNVHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H2O, generating O2 and a proton gradient that subsequently drives ATP formation. It comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Photosystem Q(B) protein 1 and what is its primary function in photosynthesis?

Photosystem Q(B) protein 1, also known as the D1 protein (encoded by the psbA1 gene), is a critical reaction center protein within Photosystem II (PSII). This integral protein functions as a core component of the water-plastoquinone oxidoreductase system that is vital to the initiation of photosynthesis and electron transport chain. The protein plays a crucial role in the early steps of light-induced electron transfer, binding plastoquinone at the Q(B) site and facilitating electron movement through the photosynthetic apparatus .

The full-length protein consists of 344 amino acids and contains transmembrane domains that anchor it within the thylakoid membrane. Its high dynamic nature under varying light conditions necessitates efficient synthesis mechanisms to maintain optimal photosynthetic efficiency . Experimental approaches to study its function typically involve spectroscopic measurements of electron transfer rates and oxygen evolution assays.

What are the optimal conditions for recombinant expression of Synechocystis D1 protein?

The recombinant expression of Synechocystis D1 protein typically employs E. coli expression systems with N-terminal His-tagging for subsequent purification purposes . Based on established protocols, the following methodological approach is recommended:

Expression System Optimization:

ParameterRecommended ConditionNotes
Expression HostE. coli BL21(DE3)Preferred due to lack of proteases
VectorpET series with T7 promoterAllows for controlled induction
Tag PositionN-terminal His-tagFacilitates purification while minimizing functional impact
Induction0.5-1.0 mM IPTGAt OD600 = 0.6-0.8
Post-Induction Temperature18-20°CLower temperature reduces inclusion body formation
Duration16-18 hoursAllows sufficient protein accumulation

When expressing membrane proteins like D1, inclusion body formation is a common challenge. Using specialized E. coli strains (such as C41/C43) or co-expression with chaperones may improve folding. Additionally, incorporating detergents during extraction (such as n-dodecyl-β-D-maltoside) helps solubilize the protein while maintaining its native conformation .

What purification strategies yield the highest purity and biological activity for recombinant D1 protein?

Purification of recombinant D1 protein requires a multi-step approach to maintain structural integrity and functionality:

Recommended Purification Workflow:

  • Initial Extraction: Carefully lyse cells in Tris/PBS-based buffer (pH 8.0) containing protease inhibitors and appropriate detergents.

  • Affinity Chromatography: Utilize Ni-NTA or similar metal affinity resins to capture the His-tagged protein. Include 6% trehalose in buffers to enhance stability during purification .

  • Size Exclusion Chromatography: Remove aggregates and further purify using gel filtration.

  • Quality Assessment: Confirm purity (>90%) using SDS-PAGE and assess functionality through activity assays .

  • Storage: Store in aliquots with 50% glycerol at -80°C to prevent freeze-thaw cycles that reduce activity .

For experimental applications requiring functional protein, reconstitution into liposomes or nanodiscs may be necessary to provide the lipid environment essential for proper folding and activity. The purified protein should be validated using western blot with anti-D1 antibodies and functional assays specific to PSII activity.

How can researchers effectively assess the functional integrity of recombinant D1 protein?

Assessing the functional integrity of recombinant D1 protein requires multiple complementary approaches:

Spectroscopic Methods:

  • Circular Dichroism (CD): To confirm proper secondary structure folding

  • Fluorescence Spectroscopy: To assess chlorophyll binding and energy transfer

  • Electron Paramagnetic Resonance (EPR): To characterize redox-active centers

Functional Assays:

  • Oxygen Evolution Measurements: Using Clark-type electrodes to measure PSII activity

  • Chlorophyll Fluorescence Analysis: To assess photochemical efficiency, as demonstrated in studies of LPE1 mutants

  • Electron Transport Assays: Using artificial electron acceptors like DCPIP

When interpreting results, researchers should account for the redox-dependent nature of D1 protein function. The light-dependent association of regulatory factors with psbA mRNA suggests that redox control mechanisms influence D1 synthesis and function . Comparative analysis between the recombinant protein and native protein extracted from thylakoid membranes provides valuable benchmarks for functional assessment.

What techniques are most effective for studying D1 protein turnover and replacement dynamics?

D1 protein exhibits unusually high turnover rates, making this an important aspect of PSII biology to study. The following methodological approaches are recommended:

In vivo Protein Labeling:

  • Pulse-chase experiments with radioactive amino acids to track synthesis and degradation rates

  • Time-course analysis following exposure to varying light intensities to assess damage-repair dynamics

Polysome Association Analysis:

  • Density gradient centrifugation to isolate polysome fractions

  • Northern blot or qRT-PCR analysis of psbA mRNA distribution across fractions to assess translation efficiency

Ribosome Profiling:

  • Deep sequencing of ribosome-protected mRNA fragments to analyze translation kinetics at single-codon resolution

  • Comparison between different light conditions and mutant backgrounds

Research has demonstrated that inefficient ribosomal loading of psbA mRNA significantly impairs D1 synthesis, as observed in LPE1-deficient mutants . This finding underscores the importance of translation regulation in maintaining PSII function. When designing experiments, researchers should consider that high light conditions accelerate D1 degradation, necessitating efficient synthesis mechanisms for PSII repair and reassembly .

How do regulatory factors like LPE1 and HCF173 interact with the D1 protein synthesis pathway?

The synthesis of D1 protein involves sophisticated regulatory mechanisms that act at the translational level:

LPE1-HCF173-psbA mRNA Regulatory Complex:

LPE1 (LOW PHOTOSYNTHETIC EFFICIENCY 1), a pentatricopeptide repeat (PPR) protein, directly binds to the 5′ UTR of psbA mRNA in a light-dependent manner through a redox-based mechanism. This binding facilitates the association of HCF173 (HIGH CHLOROPHYLL FLUORESCENCE 173) with psbA mRNA, collectively promoting the activation of D1 translation .

Experimental Approaches to Study These Interactions:

  • RNA Immunoprecipitation (RIP): To confirm specific association between regulatory proteins and psbA mRNA

  • Electrophoretic Mobility Shift Assay (EMSA): To verify direct binding between proteins and RNA targets

  • Polysome Association Analysis: To assess translational efficiency in wild-type versus mutant backgrounds

  • Co-migration Studies: Using blue native gel electrophoresis to analyze association with PSII complexes

Research has shown that LPE1 and HCF173 co-migrate with PSII monomers and supercomplexes, suggesting that psbA mRNA translation involves migration from stroma to thylakoids . The light-dependent association of LPE1 with psbA mRNA indicates that plants have evolved sophisticated mechanisms to coordinate D1 synthesis with photosynthetic activity and environmental conditions.

What approaches can be used to study D1 protein interactions within the PSII complex assembly?

Investigating D1 protein interactions within the PSII complex requires specialized techniques:

Protein-Protein Interaction Methods:

  • GST Pull-down Assays: Using GST-tagged D1 protein to identify interacting partners

  • Co-immunoprecipitation: With antibodies against D1 or other PSII subunits

  • Yeast Two-Hybrid or Split-GFP: For binary interaction mapping

  • Crosslinking Mass Spectrometry: To capture transient interactions during assembly

PSII Complex Assembly Analysis:

  • Blue Native PAGE: To separate intact PSII complexes and subcomplexes

  • Sucrose Gradient Ultracentrifugation: For isolation of assembly intermediates

  • Single-particle Electron Microscopy: To visualize complex structure and organization

Researchers have successfully employed GST-tagging of FtsH proteins in Synechocystis to study their oligomeric organization using transmission electron microscopy and single-particle analysis . Similar approaches can be applied to D1 protein to understand its integration into PSII. When designing such experiments, it's crucial to ensure that tags do not interfere with protein function or complex assembly.

What are the most common challenges in D1 protein research and how can they be addressed?

D1 protein research presents several methodological challenges that require specific solutions:

Challenge 1: Protein Instability

  • Problem: D1 protein is highly unstable when removed from its native membrane environment

  • Solution: Use stabilizing agents like trehalose (6%) in storage buffers ; avoid repeated freeze-thaw cycles; reconstitute in lipid environments that mimic thylakoid membranes

Challenge 2: Low Expression Levels

  • Problem: Membrane proteins often express poorly in heterologous systems

  • Solution: Optimize codon usage for E. coli; use specialized expression strains; consider cell-free expression systems for toxic proteins

Challenge 3: Functional Assessment

  • Problem: Recombinant D1 may not integrate properly into PSII complexes

  • Solution: Develop reconstitution systems with other PSII components; use partial activity assays focusing on specific D1 functions

Challenge 4: Light-dependent Regulation

  • Problem: D1 function and turnover are highly light-dependent

  • Solution: Conduct experiments under controlled light conditions; use redox mimetics to simulate various physiological states

When troubleshooting experiments, systematic variation of parameters is essential. For instance, if protein yields are low, testing different detergents, expression temperatures, and induction conditions can identify optimal conditions for your specific experimental setup.

How should researchers design experiments to study D1 protein function under varying light conditions?

Light is a critical variable in D1 protein research due to its influence on protein turnover and PSII activity:

Experimental Design Recommendations:

  • Light Source Characterization:

    • Precisely measure and report light intensity (μE m⁻² s⁻¹)

    • Specify spectral quality using spectroradiometer measurements

    • Ensure uniform light distribution across experimental samples

  • Light Treatment Protocols:

    • Low Light: 10-30 μE m⁻² s⁻¹ (standard growth conditions)

    • Moderate Light: 80-100 μE m⁻² s⁻¹ (mild stress)

    • High Light: >300 μE m⁻² s⁻¹ (photoinhibitory conditions)

  • Time-Course Analysis:

    • Short-term responses (minutes to hours): Focus on post-translational modifications and D1 degradation

    • Medium-term responses (hours to days): Assess translation regulation and PSII repair

    • Long-term responses (days to weeks): Evaluate acclimation strategies and stoichiometric adjustments

  • Mutant Analysis:

    • Compare wild-type and mutant responses (e.g., LPE1-deficient) under identical light conditions

    • Assess PSII activity using chlorophyll fluorescence parameters (Fv/Fm, NPQ, qI)

Research has shown that high light exposure aggravates D1 accumulation defects in LPE1-deficient mutants due to faster degradation coupled with inefficient synthesis . This demonstrates the importance of coordinated synthesis and degradation processes in maintaining PSII function under varying light conditions.

How does D1 protein structure and function vary across different photosynthetic organisms?

D1 protein shows remarkable conservation across photosynthetic organisms while exhibiting species-specific adaptations:

Comparative Analysis Framework:

Organism TypeD1 Protein CharacteristicsFunctional ImplicationsResearch Methods
Cyanobacteria (e.g., Synechocystis)Multiple psbA gene copies (psbA1, psbA2, psbA3); D1 as primary PSII componentDifferential expression under varying conditions; basis for primitive photosynthesisGenetic manipulation; comparative genomics; heterologous expression
Green AlgaeFewer psbA copies; chloroplast-encodedEvolutionary intermediate; model for eukaryotic photosynthesisChloroplast transformation; comparative physiology
Higher PlantsSingle psbA gene in chloroplast genome; sophisticated nuclear-encoded regulatorsComplex regulatory mechanisms involving nuclear and chloroplast coordinationNuclear-chloroplast signaling studies; mutant analysis

To investigate these differences experimentally, researchers should employ:

  • Sequence Alignment and Structural Modeling: To identify conserved domains and variable regions

  • Heterologous Expression: Express D1 variants from different species in a common host

  • Functional Complementation: Test if D1 from one species can rescue mutants of another

  • Domain Swapping: Create chimeric D1 proteins to identify species-specific functional domains

Research has demonstrated that while primitive and higher photosynthetic organisms share conserved mechanisms for PSII function, they employ distinct regulatory factors like LPE1 in higher plants to control D1 synthesis . This evolutionary divergence reflects adaptation to different ecological niches and light environments.

What methodological approaches can reveal the integration of D1 into different PSII supercomplexes?

PSII exists in various supercomplexes with differing subunit compositions across species:

Methodological Approaches:

  • Membrane Fractionation:

    • Differential centrifugation to separate thylakoid membrane domains

    • Detergent solubilization using varying detergent:protein ratios to preserve different complexes

  • Native Complex Isolation:

    • Blue native PAGE combined with second-dimension SDS-PAGE

    • Sucrose density gradient ultracentrifugation followed by western blotting

  • Structural Characterization:

    • Cryo-electron microscopy of isolated complexes

    • Mass spectrometry to identify interaction partners and post-translational modifications

    • Single-particle analysis to reveal complex organization

  • Dynamic Assembly Studies:

    • Pulse-chase labeling combined with complex isolation

    • Time-resolved structural analysis following light exposure or inhibitor treatment

Research shows that D1 synthesis and membrane insertion occur in a concerted manner at the thylakoid membrane . The distribution of regulatory factors like LPE1 and HCF173 in both thylakoids and stroma, along with their co-migration with PSII monomers and supercomplexes, suggests that psbA mRNA translation involves migration between these compartments . These findings highlight the sophisticated spatial organization of D1 synthesis and PSII assembly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.