Recombinant Synechocystis sp. Photosystem Q (B) protein 2

Shipped with Ice Packs
In Stock

Description

Recombinant Synechocystis sp. Photosystem Q(B) Protein 2: Overview

Recombinant Synechocystis sp. Photosystem Q(B) protein 2 (Cat. No.: RFL15096SF) is a recombinant form of the D1 protein (encoded by psbA2), a core component of Photosystem II (PSII) in cyanobacteria. This protein is critical for light-driven electron transfer, water oxidation, and quinone (Qₐ/Qᴮ) binding in the PSII reaction center. The recombinant version is expressed in E. coli with an N-terminal His tag (1–344 amino acids) and purified to >90% homogeneity via SDS-PAGE .

Role in Photosystem II (PSII) Assembly and Function

The D1 protein forms the reaction center core of PSII, coordinating the redox-active quinones Qₐ and Qᴮ. Mutations in D1 (e.g., T192H) disrupt PSII assembly, leading to photoheterotrophy . The recombinant form may aid studies on:

  1. Protein Folding: Slr2013 (a D2 chaperone) stabilizes D1 folding; its truncation partially rescues PSII activity in mutants .

  2. Electron Transfer Kinetics: Charge recombination between Qₐ⁻ and the donor side is faster in mutants (30% increase) .

  3. Oxygen-Evolving Complex (OEC) Stability: D1 mutations alter Yᴰ (tyrosine donor) oxidation kinetics and Ca²⁺ affinity .

Comparative Analysis: Native vs. Recombinant D1

AspectNative D1Recombinant D1
SourceSynechocystis sp. PCC 6803E. coli
Post-Translational ModificationsNative lipid modificationsAbsent (bacterial expression)
ApplicationsIn vivo studies, structural biologyIn vitro assays, crystallography, binding studies
StabilityLabile due to light-induced damageStabilized for storage (e.g., trehalose)

Research Gaps and Future Directions

While the recombinant D1 protein is biochemically characterized, its role in de novo PSII assembly or repair mechanisms remains understudied. Potential applications include:

  • Structural Studies: Cryo-EM of recombinant D1 with bound quinones.

  • Mutant Analysis: Engineering T192H or Yᴰ variants to probe electron transfer pathways .

  • Interactions with Assembly Factors: Co-purification with Slr2013 or Psb29 (a conserved assembly factor) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
psbA2; psbA-2; slr1311; psbA3; psbA-3; sll1867; Photosystem II protein D1 2; PSII D1 protein 2; Photosystem II Q(B protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
psbA2
Target Protein Sequence
MTTTLQQRESASLWEQFCQWVTSTNNRIYVGWFGTLMIPTLLTATTCFIIAFIAAPPVDI DGIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVVFHFL IGIFCYMGRQWELSYRLGMRPWICVAYSAPVSAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEVESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVIGIWFTAMGVSTMAFNLNGF NFNQSILDSQGRVIGTWADVLNRANIGFEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient, which is subsequently used for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transport chain that converts light excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of PsbQ protein in cyanobacterial Photosystem II?

PsbQ is one of five extrinsic proteins (alongside PsbO, PsbP, PsbU, and PsbV) associated with cyanobacterial Photosystem II complexes. Research has demonstrated that PsbQ defines the fully assembled and optimally active form of PSII. PSII complexes containing PsbQ exhibit higher activity and stability compared to those lacking this protein, indicating its essential role in optimizing photosynthetic function . The presence of PsbQ appears to be a marker for complete assembly of the oxygen-evolving complex, making it a critical component for researchers studying photosynthetic efficiency in cyanobacteria.

How does the assembly of Photosystem II in Synechocystis sp. PCC 6803 differ from other photosynthetic organisms?

Synechocystis sp. PCC 6803 utilizes specific assembly factors like Slr2013 that are not found in eukaryotic photosynthetic organisms. While Slr2013 homologs exist in other cyanobacteria (including Nostoc punctiforme, Anabaena sp. strain PCC 7120, and Thermosynechococcus elongatus BP-1) and in some other prokaryotes (Eubacteria and Archaea), these proteins are absent in eukaryotes . This fundamental difference in assembly machinery highlights the evolutionary divergence of photosynthetic systems and necessitates specialized research approaches when studying cyanobacterial photosystems.

What experimental evidence demonstrates that PsbQ interacts with other PSII extrinsic proteins?

The interaction between PsbQ and other PSII extrinsic proteins has been conclusively demonstrated through polyhistidine-tagging of PsbQ followed by affinity purification. This technique successfully co-purified PsbO, PsbU, and PsbV proteins along with PsbQ, confirming their association in the same PSII complex . This was the first successful purification of PSII complexes using a tagged extrinsic protein rather than an integral membrane component, providing strong evidence for the stable integration of PsbQ within the functional PSII assembly.

What are the most effective techniques for isolating fully assembled PSII complexes containing PsbQ?

For isolating intact PSII complexes containing PsbQ, affinity chromatography using polyhistidine-tagged PsbQ has proven superior to traditional methods. This approach yields PSII complexes with higher activity and stability compared to those isolated using histidine-tagged CP47 (an integral membrane protein) . The protocol typically involves:

  • Expression of His-tagged PsbQ in Synechocystis sp. PCC 6803

  • Cell disruption under non-denaturing conditions

  • Membrane solubilization with appropriate detergents

  • Affinity purification using nickel columns

  • Elution with imidazole gradient

  • Verification of complex integrity through activity measurements and subunit composition analysis

This method ensures isolation of the fully assembled, optimally active form of the enzyme with all associated extrinsic proteins intact.

How can researchers generate and select for photosystem mutants in Synechocystis sp. PCC 6803?

Generation and selection of photosystem mutants in Synechocystis sp. PCC 6803 typically follows a multi-step process:

  • Creation of site-directed mutations through PCR-based methods or Gibson cloning

  • Transformation of Synechocystis during exponential growth phase when transformation efficiency is highest

  • Selection under appropriate conditions (e.g., photoheterotrophic growth for PSII-deficient mutants)

  • Confirmation of mutations through DNA sequencing

  • Selection of pseudorevertants by changing growth conditions (e.g., plating photoheterotrophic mutants on media without glucose to select for photoautotrophic growth)

For example, the Rg2 pseudorevertant of the T192H mutant was selected by plating T192H cultures on solid BG-11 medium without glucose, followed by screening for colonies capable of photoautotrophic growth while still containing the original T192H mutation .

What spectroscopic methods are most informative for characterizing PSII assembly defects?

Several spectroscopic techniques provide valuable insights into PSII assembly defects:

  • Low-temperature (77K) fluorescence emission spectroscopy: Particularly useful for detecting the absence of the characteristic 695 nm emission peak, which indicates functional PSII. The T192H mutant lacking assembled PSII centers shows absence of this peak .

  • Electron Paramagnetic Resonance (EPR): Essential for studying redox-active components like YD. Altered decay kinetics of YDox can reveal structural changes in the protein environment surrounding these components .

  • Chlorophyll fluorescence decay kinetics: Measures charge recombination between QA and the donor side of PSII, reflecting midpoint redox potentials of contributing cofactors. For example, the Rg2 pseudorevertant exhibited a 30% shorter half-time of fluorescence decay (320±30 ms) compared to wild-type (440±42 ms) .

These techniques, when used in combination, provide comprehensive insights into both structural assembly and functional integrity of PSII complexes.

How does the Slr2013 protein regulate functional assembly of Photosystem II?

Slr2013 plays a critical role in regulating the functional assembly of Photosystem II, particularly in the folding of the D2 protein. Evidence for this regulatory role comes from studies of the T192H mutant and its Rg2 pseudorevertant:

  • The T192H mutation in D2 prevents stable assembly of PSII complexes, resulting in obligate photoheterotrophy due to lack of functional PSII .

  • Early termination at position 294 in the Slr2013 protein (in the Rg2 pseudorevertant) restores photoautotrophic growth despite retention of the T192H mutation .

  • The truncated Slr2013 allows formation of fully functional PSII reaction centers with only minor alterations in electron transfer properties (30% higher charge recombination rate between QA- and donor side, reduced stability of oxidized YD) .

These findings suggest that Slr2013 functions as a quality control factor during PSII assembly, potentially preventing incorporation of imperfectly folded D2 subunits into functional complexes. When truncated, this quality control mechanism is relaxed, allowing slightly altered but functional PSII complexes to assemble .

What molecular changes occur in the Rg2 pseudorevertant that allow it to overcome the T192H mutation effects?

The Rg2 pseudorevertant overcomes the effects of the T192H mutation through specific molecular adaptations:

  • Truncation of Slr2013 at position 294 allows assembly of PSII complexes despite the presence of the T192H mutation in D2 .

  • The assembled PSII complexes show altered but functional electron transfer properties:

    • 30% faster charge recombination between QA- and the donor side (320±30 ms vs. 440±42 ms in wild-type)

    • 2.5 times faster decay kinetics of YDox compared to wild-type

  • These changes suggest that while the T192H mutation causes structural alterations in the D2 protein (particularly near His189, the primary proton acceptor for YD), these alterations do not directly impact the electron transfer components but rather affect protein folding and/or stable assembly .

The functional complementation mapping of the secondary mutation to the region containing slr2013 confirms that this adaptation occurs through changes in the assembly process rather than direct compensation within the D2 protein itself .

What are the evolutionary implications of the differential distribution of Slr2013 homologs across kingdoms?

The differential distribution of Slr2013 homologs provides important evolutionary insights:

This distribution pattern suggests that:

  • Slr2013 represents an ancient protein family that predates the divergence of Eubacteria and Archaea

  • The protein may have been lost during the endosymbiotic event that gave rise to chloroplasts

  • Eukaryotic photosynthetic organisms likely evolved alternative mechanisms for PSII assembly quality control

The conservation of Slr2013 across prokaryotic lineages, coupled with its DUF58 family signature (Domain of Unknown Function), suggests it performs a fundamental cellular function beyond just PSII assembly, as evidenced by the inability to completely delete the gene even under conditions where PSII is dispensable .

How can researchers differentiate between assembly defects and functional defects in PSII mutants?

Differentiating between assembly and functional defects requires a systematic approach combining multiple analytical techniques:

TechniqueAssembly Defect IndicatorsFunctional Defect Indicators
77K FluorescenceAbsence of 695 nm emission peakPresent 695 nm peak but altered relative intensity
Oxygen EvolutionComplete absence of activityReduced but measurable activity
Protein Gel AnalysisMissing PSII subunitsAll subunits present but altered activity
Electron MicroscopyAbsence of characteristic PSII structuresIntact structures with altered activity
Charge Recombination KineticsN/A - requires assembled complexesAltered kinetics compared to wild-type

For example, the T192H mutant shows a clear assembly defect (no 695 nm fluorescence peak, no oxygen evolution), while the Rg2 pseudorevertant exhibits primarily functional alterations (30% faster charge recombination, 2.5× faster YDox decay) despite containing fully assembled PSII centers .

What approaches can resolve contradictions between spectroscopic data and biochemical analyses of PSII complexes?

When spectroscopic and biochemical data yield contradictory results, researchers should:

  • Verify sample preparation consistency - different isolation methods can yield PSII populations with varying degrees of intactness and subunit composition. For example, using His-tagged PsbQ for isolation yields more active complexes than using His-tagged CP47 .

  • Examine time-dependent changes - spectroscopic measurements often capture transient states while biochemical analyses represent steady-state conditions.

  • Consider heterogeneity - at any given moment, cells contain a mixture of PSII complexes in various assembly states. This heterogeneity can lead to apparently contradictory results when different techniques sample different subpopulations .

  • Perform complementary measurements - for example, combine low-temperature fluorescence (to assess assembly) with oxygen evolution measurements (to assess function) and EPR (to assess specific redox-active components).

  • Use genetic approaches - create targeted mutants to test specific hypotheses about protein interactions and functions, as was done with the mapping of the secondary mutation in the Rg2 pseudorevertant .

What factors contribute to variability in PSII activity measurements across different studies?

Several factors contribute to variability in PSII activity measurements:

  • Isolation methods: Different purification approaches yield PSII complexes with varying degrees of integrity and subunit composition. For example, PsbQ-based isolation yields higher activity complexes than CP47-based methods .

  • Growth conditions: Light intensity, nutrient availability, and growth phase significantly impact PSII assembly and activity. The T192H mutant showed consistent lack of PSII assembly regardless of light conditions (normal or low-light/LAHG conditions) .

  • Measurement conditions: Temperature, pH, electron acceptors/donors, and light intensity during measurements all affect observed activity rates.

  • Genetic background: Laboratory strains develop subtle genetic differences over time. Different "wild-type" reference strains may exhibit baseline differences in PSII activity.

  • PSII heterogeneity: The dynamic assembly/disassembly of PSII means that any preparation contains complexes in various states, and the distribution varies between studies .

Researchers should standardize conditions as much as possible and clearly report all relevant parameters to facilitate meaningful cross-study comparisons.

What unresolved questions remain about the dual roles of Slr2013 in Synechocystis sp. PCC 6803?

Several critical questions about Slr2013 remain unresolved:

  • What is the molecular mechanism by which Slr2013 regulates PSII assembly? Does it act as a chaperone, a quality control factor, or through another mechanism?

  • What is the essential non-PSII related function of Slr2013, given that the gene cannot be completely deleted even under conditions where PSII is dispensable?

  • How does the DUF58 domain contribute to Slr2013 function, and what structural features enable it to recognize misfolded D2 protein?

  • What is the evolutionary relationship between Slr2013 and its homologs in other prokaryotes, and how have their functions diverged or been conserved?

  • How does truncation of Slr2013 specifically counteract the effects of the T192H mutation in D2? Are there other D2 mutations that can be suppressed by Slr2013 modification?

Addressing these questions will require integrated structural, functional, and evolutionary approaches to fully understand this multifunctional protein.

How might advanced structural biology techniques enhance our understanding of PsbQ interactions in PSII?

Advanced structural biology techniques could revolutionize our understanding of PsbQ's role in PSII:

  • Cryo-electron microscopy (Cryo-EM): Could reveal the precise positioning of PsbQ relative to other extrinsic proteins (PsbO, PsbU, PsbV) and the membrane-intrinsic core, potentially identifying interaction interfaces and structural changes induced by PsbQ binding.

  • Cross-linking mass spectrometry: Would identify specific amino acid residues involved in PsbQ interactions with other PSII components, providing targets for site-directed mutagenesis studies.

  • Hydrogen-deuterium exchange mass spectrometry: Could reveal conformational changes in PSII components induced by PsbQ binding, helping to explain how PsbQ enhances PSII stability and activity.

  • Time-resolved X-ray crystallography: Would capture dynamic structural changes during PSII function, potentially revealing how PsbQ influences water oxidation and electron transfer processes.

  • In situ structural techniques: Such as electron tomography could visualize PSII-PsbQ complexes in their native membrane environment, providing insights into higher-order organization and interactions.

These approaches would build upon the biochemical evidence that PsbQ-containing PSII complexes show enhanced activity and stability , providing molecular explanations for these observations.

What potential applications exist for engineered Synechocystis sp. PCC 6803 strains with enhanced photosystem stability?

Engineered Synechocystis strains with enhanced photosystem stability could advance several research and application areas:

  • Fundamental research: More stable PSII complexes would facilitate structural and mechanistic studies that are currently limited by protein instability during purification and analysis.

  • Biofuel production: Enhanced photosynthetic efficiency could improve hydrogen production via the bidirectional NiFe-hydrogenase (HoxEFUYH) present in Synechocystis sp. PCC 6803 .

  • Biosensors: Stable PSII complexes could serve as components in biosensors for environmental pollutants that inhibit photosynthesis.

  • Synthetic biology platforms: Robust photosynthetic machinery could provide reliable energy input for engineered metabolic pathways producing high-value compounds.

  • Climate change mitigation research: Optimized photosynthetic systems could inform strategies for enhancing carbon fixation efficiency in both natural and engineered systems.

Engineering these enhanced strains would require comprehensive understanding of assembly factors like Slr2013 and stability-enhancing components like PsbQ , highlighting the importance of basic research for enabling these applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.