Recombinant Synechocystis sp. Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
kdpC; slr1730; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
kdpC
Target Protein Sequence
MIRNFVISLRSTALLWILTALIYPAIVLVIGQLVFPYQANGSLITDSQGQVVGSALIGQT FTEEGYFWSRPSAINYSEGADASPTGISGASNLAPSNPDLLSRIEAEAQRLEDNAVQPTA DLLYSSGSGLDPHISPAAAQAQFDRVAKARSIPPQELQSLITKHTEGRFLGIFGEPGVNV LTLNLALDNR
Uniprot No.

Target Background

Function

The Recombinant Synechocystis sp. Potassium-transporting ATPase C chain (KdpC) is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. KdpC functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.

Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the Kdp system in Synechocystis sp. PCC 6803 and how does it function?

The Kdp system in Synechocystis sp. PCC 6803 is an ATP-dependent potassium transport system that helps maintain K+ homeostasis under conditions of limited external potassium. In Synechocystis, the Kdp proteins are encoded by the kdpABGCD operon, where KdpA is predicted to be a membrane protein containing K+-conducting-pore regions . Unlike the constitutively expressed Ktr system (another K+ transporter in Synechocystis), the Kdp system is primarily induced under potassium-limiting conditions .

The Kdp system functions as a P-type ATPase, using ATP hydrolysis to drive potassium uptake. While Kdp complements K+ uptake in E. coli, it does so at lower rates than the Ktr system. Experimental evidence shows that Kdp primarily contributes to maintaining basal intracellular K+ concentration under potassium-limited conditions, whereas Ktr mediates faster potassium movements when K+ is more available .

How is the Kdp system regulated in Synechocystis compared to other bacteria?

In Synechocystis sp. PCC 6803, the regulation of the Kdp system differs notably from the well-characterized system in E. coli:

FeatureE. coli Kdp RegulationSynechocystis Kdp Regulation
Regulatory genesKdpD/KdpE two-component systemHik20/Rre19 two-component system
Gene arrangementkdpDE operon adjacent to kdpFABCTwo-component system genes hik20 and rre19 adjacent to kdpABGCD
KdpD structureSingle proteinSplit into two separate parts
Primary inductionOsmotic stress and K+ limitationPrimarily K+ depletion
Circadian controlNot reportedExpression peaks at subjective dawn

The Kdp system in Synechocystis is primarily induced by extracellular K+ depletion. This induction depends on two adjacent genes, hik20 and rre19, which encode a putative two-component regulatory system . Interestingly, the circadian expression of kdp genes peaks at subjective dawn, which may support the acquisition of K+ required for the regular diurnal photosynthetic metabolism .

What cellular processes depend on proper KdpC function in Synechocystis?

KdpC is essential for several physiological processes in Synechocystis sp. PCC 6803:

  • Potassium homeostasis: KdpC is a critical component of the Kdp complex that maintains cellular K+ levels, particularly under K+ limitation .

  • Osmotic stress response: While the Ktr system plays the primary role in the initial response to hyperosmotic shock, the Kdp system (including KdpC) contributes to long-term adaptation .

  • pH adaptation: The Kdp system is involved in adaptation to acidic pH, with KdpC being a necessary component for this function .

  • Photosynthetic metabolism: The circadian expression pattern of Kdp components suggests a role in supporting diurnal photosynthetic processes .

  • High-light stress management: The Kdp transport system contributes to preventing oxidative stress under high-light conditions, with KdpC being an integral part of this complex .

What methods are most effective for expressing recombinant Synechocystis kdpC in E. coli?

For successful expression of recombinant Synechocystis kdpC in E. coli, the following methodological approach has proven effective:

  • Gene amplification and cloning:

    • Amplify the kdpABGCD region by PCR using specific primers containing appropriate restriction sites (e.g., SacI site-containing forward primer and PstI site-containing reverse primer)

    • Use Synechocystis genomic DNA as the template

    • Digest the PCR fragment with appropriate restriction enzymes and ligate into a suitable expression vector (e.g., pPAB404)

  • Expression conditions:

    • Transform into an E. coli strain lacking endogenous K+ uptake systems (e.g., E. coli LB2003)

    • Culture in the presence of 30 mM KCl, 0.25 mM IPTG, and appropriate antibiotics for selection

    • Maintain growth at 30°C for 24 hours

  • Verification of expression and function:

    • Wash precultures with synthetic medium without KCl

    • Test functionality by growing transformants on synthetic agar medium with varying KCl concentrations (7.5, 10, 15, or 20 mM)

    • Monitor growth curves in synthetic medium containing 15 mM KCl

    • Measure K+ uptake using flame photometry and the silicone filtration technique

This approach allows for both expression and functional assessment of the recombinant Synechocystis KdpC protein in the E. coli system.

How can I create and verify kdpC deletion mutants in Synechocystis?

Creating a kdpC deletion mutant in Synechocystis sp. PCC 6803 requires a systematic approach:

  • Construct preparation:

    • Design a construct with an antibiotic resistance cassette (e.g., spectinomycin resistance) flanked by sequences homologous to regions upstream and downstream of the kdpC gene

    • For Gibson cloning, assemble three fragments into a suitable vector like pBluescript SK(+)

  • Transformation and selection:

    • Transform Synechocystis cells in exponential growth phase for maximum efficiency

    • Mix 300 μl of concentrated cell suspension with 6-18 μg plasmid DNA and incubate for 6 hours at 30°C in darkness

    • Plate on BG11 agar without antibiotics initially, then add antibiotics on the third day

    • Single colonies typically appear after 2 weeks

  • Segregation and verification:

    • Streak single colonies on new BG11 agar plates with antibiotics 6-8 times to ensure complete segregation

    • Verify successful deletion and complete segregation using either:
      a) PCR with primers flanking the targeted region
      b) Southern hybridization

    • For additional confirmation, sequence PCR products spanning the deletion site

  • Physiological verification:

    • Test growth under K+-depleted conditions to confirm the expected phenotype

    • Measure K+ uptake capability using flame photometry or ion-specific electrodes

    • Assess cell viability under various stress conditions where KdpC might play a role (K+ limitation, pH shifts, high light)

This methodical approach ensures the creation of verified kdpC deletion mutants suitable for further functional studies.

What methods are used to measure the impact of kdpC mutations on K+ transport?

Several complementary methods can effectively measure the impact of kdpC mutations on K+ transport in Synechocystis:

  • Direct K+ uptake measurement:

    • Use the silicone filtration technique followed by flame photometry to determine K+ content in cell pellets

    • Calculate net K+ uptake rates under different external K+ concentrations

    • Compare wild-type and mutant strains to quantify the specific contribution of KdpC

  • Growth assays under K+ limitation:

    • Wash cells with K+-depleted BG11 medium

    • Dilute to an OD730 of 0.05 in K+-depleted BG11 medium with varying KCl concentrations

    • Monitor growth over time to assess the ability to survive under K+ limitation

    • Growth patterns between wild-type and mutant strains reveal functional consequences of kdpC mutations

  • Volume recovery after hyperosmotic shock:

    • Use an on-chip microfluidic device to monitor the biphasic initial volume recovery of single cells after hyperosmotic shock

    • Compare the recovery kinetics between wild-type and kdpC mutant strains

    • This approach specifically reveals the role of K+ transporters in osmotic adaptation

  • Reporter gene assays for kdp expression:

    • Construct strains containing PkdpA::lacZ fusions to monitor kdp operon expression

    • Measure β-galactosidase activity under various conditions to determine how regulatory mechanisms are affected by kdpC mutations

These methods provide complementary data on both the functional impact of kdpC mutations on K+ transport and the regulatory consequences at the transcriptional level.

How does Synechocystis KdpC differ functionally from E. coli KdpC in complementation studies?

Complementation studies reveal significant functional differences between Synechocystis and E. coli KdpC:

Detailed analysis reveals that in E. coli, KdpC cannot be functionally replaced by Synechocystis KdpC, unlike with the M. tuberculosis homolog which does complement E. coli KdpC function . This suggests significant structural or functional divergence in the Synechocystis KdpC protein.

Sequence alignment and hybrid construction studies indicate that specific regions of KdpC are critical for function. In particular, studies with C. acetobutylicum KdpC showed that while the N-terminal transmembrane segment and C-terminal third can be individually exchanged with E. coli KdpC, simultaneous substitution of both regions prevents complementation . This indicates complex structural constraints that likely also apply to Synechocystis KdpC.

How do transcriptomic analyses inform our understanding of kdpC regulation in Synechocystis?

Transcriptomic analyses provide crucial insights into kdpC regulation within the broader context of Synechocystis gene expression:

  • Condition-specific expression patterns:
    Comprehensive RNA-seq and differential RNA-seq (dRNA-seq) analyses across 10 different environmental conditions have mapped the transcriptional start sites active under each condition . These analyses revealed that:

    • kdp operon expression is strongly induced under K+ limitation

    • Expression shows circadian patterns, peaking at subjective dawn

    • Expression is also affected by changes in carbon availability and osmotic stress

  • Operon structure and regulatory elements:
    Transcriptome mapping has identified 4,091 transcriptional units in Synechocystis, providing detailed information about:

    • Operon boundaries that include the kdpABGCD genes

    • 5' and 3' untranslated regions (UTRs) that may contain regulatory elements

    • Promoter sequences at single-nucleotide resolution that drive kdp expression

  • Stress-responsive regulation:
    Comparative transcriptome analysis across different stress conditions has revealed:

    • kdp operon expression is part of specific regulons responding to K+ limitation

    • Expression patterns correlate with other genes involved in ion homeostasis

    • The two-component system genes hik20 and rre19 are required for proper induction of kdp expression

  • Integration with metabolic shifts:
    Combined transcriptomic and metabolomic analyses show that:

    • Changes in kdp expression correlate with shifts in central metabolism

    • Carbon and nitrogen metabolism adjustments occur simultaneously with changes in K+ homeostasis systems

    • These connections suggest coordinated regulation of energy metabolism and ion transport

These transcriptomic findings collectively provide a systems-level understanding of how kdpC expression is regulated in response to environmental changes and integrated with broader cellular metabolism.

How can genome engineering techniques be optimized for modifying kdpC in Synechocystis?

Advanced genome engineering of kdpC in Synechocystis can be optimized using several cutting-edge approaches:

  • Markerless transformation systems:

    • Implement two-step transformation processes that allow removal of antibiotic markers after successful integration

    • This approach is particularly valuable for multiple genetic modifications and avoids potential polar effects on downstream genes in the kdp operon

    • Methodology must be adapted for the polyploid nature of Synechocystis genome

  • CRISPR interference (CRISPRi) for kdpC modulation:

    • Design sgRNAs targeting kdpC with optimal positioning relative to the start codon

    • Research shows that sgRNA effectiveness depends on distance to the promoter, with positions 1-3 showing strongest repression effects

    • Target multiple positions within kdpC to ensure complete repression

    • This approach allows tunable repression rather than complete knockout

  • Promoter engineering for controlled expression:

    • Replace the native kdp promoter with the strong inducible trc promoter

    • Integration can be performed at a neutral site near slr0846 or IS203c, or by direct replacement of the promoter

    • This allows controlled expression for functional studies

    • Engineer synthetic variants of the native promoter with modified -10/-35 elements to achieve different expression levels

  • Codon optimization strategies:

    • Optimize kdpC codons based on the high-GC content preference of Synechocystis

    • This approach can significantly improve expression levels

    • Consider using established Synechocystis-optimized selection markers like the kanamycin resistance cassette (BBa_K1424003) as templates for optimization strategy

  • Verification of complete segregation:

    • Design PCR primers flanking the integration site to verify complete replacement in all genome copies

    • Use quantitative PCR to determine if any wild-type copies remain

    • For Synechocystis, repeated streaking on selective media (6-8 rounds) is typically required for complete segregation

These optimized engineering approaches enable precise modification of kdpC for functional studies while minimizing unintended effects on cell physiology.

What role does KdpC play in the stress response network of Synechocystis?

KdpC functions as an integral part of a broader stress response network in Synechocystis, with connections to multiple cellular processes:

  • Integration with multiple stress responses:
    Physiological studies comparing wild-type and mutant strains reveal that the Kdp system, including KdpC, contributes to adaptation under several stress conditions:

    • Heavy metal stress: Unlike the SynK K+ channel, Kdp does not significantly contribute to heavy metal resistance

    • Osmotic and salt stress: Kdp works synergistically with Ktr for adaptation

    • Acidic pH adaptation: The Kdp system plays an important role in adapting to low pH environments

    • High-light stress: Kdp/Ktr and SynK act synergistically to avoid oxidative stress and ensure cell viability under high-light conditions

  • Connection to carbon metabolism:

    • The Kdp system may influence the CO2 concentration mechanism via effects on bicarbonate transporters

    • Kdp also appears to play a role in processes related to calcification

    • Integrated transcriptomic and metabolomic analyses show coordinated changes in K+ transport systems and carbon metabolism during acclimation to changing CO2 levels

  • Involvement in circadian processes:

    • The circadian expression of kdp genes, including kdpC, peaks at subjective dawn

    • This timing suggests coordination with the diurnal cycle of photosynthetic metabolism

    • KdpC likely contributes to the K+ homeostasis required for optimal photosynthetic function throughout the day-night cycle

  • Interaction with biofilm formation:

    • Synechocystis forms bloom-like cell aggregates embedded in sulfated extracellular polysaccharides (synechan)

    • K+ homeostasis systems, including Kdp, may influence the formation and integrity of these biofilm-like structures

    • The relationship between K+ transport and exopolysaccharide production represents an emerging area for investigation

This complex integration of KdpC into multiple stress response networks demonstrates its importance beyond simple K+ uptake, positioning it as a component in the broader cellular adaptation strategies of Synechocystis.

What are the key unresolved questions about Synechocystis KdpC that present opportunities for future research?

Several critical questions about Synechocystis KdpC remain unresolved and offer promising avenues for future research:

  • Structural determinants of function:

    • What specific structural features of Synechocystis KdpC prevent complementation in E. coli?

    • How does the three-dimensional structure of Synechocystis KdpC differ from better-characterized bacterial homologs?

    • Which amino acid residues are critical for species-specific functions?

  • Regulatory interactions:

    • How does KdpC interact with the unique two-component regulatory system in Synechocystis?

    • What molecular mechanisms connect KdpC function to circadian regulation?

    • Are there post-translational modifications of KdpC that influence its activity?

  • System integration:

    • How does KdpC function coordinate with other K+ transport systems in different environmental scenarios?

    • What is the precise role of KdpC in photosynthetic metabolism and high-light stress adaptation?

    • How does KdpC contribute to cellular responses during transitions between different growth modes?

  • Biotechnological applications:

    • Can engineered variants of KdpC improve cyanobacterial resilience for biotechnology applications?

    • How might manipulation of KdpC impact the production of biofuels or other valuable compounds in engineered Synechocystis strains?

    • Could insights from Synechocystis KdpC inform the engineering of K+ transport in other photosynthetic organisms?

  • Evolutionary significance:

    • What selective pressures drove the divergence of Synechocystis KdpC from other bacterial homologs?

    • How does the functional role of KdpC in Synechocystis reflect adaptation to specific ecological niches?

    • What can comparative genomics of KdpC across cyanobacterial species reveal about its evolution?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.