Recombinant Synechocystis sp. Probable diacylglycerol kinase (dgkA)

Shipped with Ice Packs
In Stock

Description

Introduction

Synechocystis sp. PCC 6803, a model cyanobacterium, has been the subject of extensive research aimed at understanding its metabolic pathways and stress response mechanisms . Among the key enzymes studied in Synechocystis is diacylglycerol kinase (DgkA), which plays a crucial role in lipid metabolism. Genes, such as slr2103, a Synechocystis homolog of type-2 diacylglycerol acyltransferase genes, are essential for synthesizing specific lipids . Understanding the function and regulation of DgkA can provide insights into the cyanobacterium's adaptation to environmental changes and its potential for biotechnological applications.

Function and Role in Lipid Metabolism

Diacylglycerol kinase (DgkA) catalyzes the phosphorylation of diacylglycerol (DAG) to produce phosphatidic acid (PA), a key signaling lipid . In Synechocystis, DgkA is involved in various cellular processes, including lipid synthesis and stress response . Specifically, the slr2103 gene, a homolog of type-2 diacylglycerol acyltransferase genes, is essential for lipid X synthesis . Disruption of slr2103 causes Synechocystis cells to accumulate plastoquinone-C at an abnormally high level, whereas overexpression of slr2103 in Synechococcus causes the cells to almost completely lose it .

Experimental Studies and Research Findings

Several studies have focused on the function and regulation of DgkA in Synechocystis. Disruption of the slr2103 gene in Synechocystis affects sedimented-cell growth in static culture and promotes cell aggregation and floatation upon saline stress . Overexpression of slr2103 in Synechococcus elongatus PCC 7942 leads to the appearance of lipid X, which is intrinsically lacking in this strain .
Experiments using recombinant DrgA protein have demonstrated its role in electron transfer within the thylakoid membrane . The addition of recombinant DrgA protein and NADPH to DCMU-treated isolated thylakoid membranes increases the dark re-reduction rate of the photosystem I reaction center (P700(+)) .

Role in Stress Response

Synechocystis utilizes various strategies to acclimatize to environmental stresses, including saline stress . The slr2103 gene contributes to bloom-like structure formation and its expansion by promoting cell aggregation and floatation upon imposition of saline stress (0.3-0.6 M NaCl) . These observations provide insights into the molecular mechanism of a novel cyanobacterial strategy to acclimatize to saline stress and develop a system of seawater-utilization and economical harvesting of cyanobacterial cells with high-value added compounds or blooming control of toxic cyanobacteria .

DgkA in Other Organisms

Diacylglycerol kinases are widespread in various organisms, including higher plants and yeast . In Saccharomyces cerevisiae, Dgk1p (ScDGK1) is a unique CTP-dependent enzyme that catalyzes the formation of PA from DAG . Alignment of plant DGK sequences with ScDGK1 demonstrates that the ATP-binding site is conserved in all DGK catalytic domains in plants .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
dgkA; slr0054; Diacylglycerol kinase; DAGK; Diglyceride kinase; DGK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
Target Protein Sequence
MKSVYPMSSPSSAVFADQGLSGKANQTQPPPPLGLVVPASKPGAKKPLRKNAWQVAPNLL VSFRYAWAGVSYAFATQRNFRIHTFTGVAVITAASLLHLEAIAVAVLALTSCLVMILELL NTALESVVDLTVGQSYHELAKIAKDCAAGAVLLAAIAAVIVGGCLLLPPLLSLMV
Uniprot No.

Target Background

Function
This recombinant Synechocystis sp. probable diacylglycerol kinase (dgkA) catalyzes the ATP-dependent phosphorylation of sn-1,2-diacylglycerol (DAG) to phosphatidic acid.
Database Links
Protein Families
Bacterial diacylglycerol kinase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is diacylglycerol kinase (dgkA) and what is its basic function in Synechocystis sp.?

Diacylglycerol kinase (dgkA) catalyzes the ATP-dependent phosphorylation of diacylglycerol (DG) to phosphatidic acid (PA). This reaction represents a critical node in lipid metabolism where both substrate and product serve as important signaling molecules. Similar to other DGKs, the Synechocystis sp. dgkA likely plays a role in modulating the balance between DG and PA signaling pathways .

Methodologically, to study the basic function of dgkA in Synechocystis sp., researchers typically employ:

  • Gene knockout/mutation strategies to observe phenotypic changes

  • Activity assays to measure the conversion of DG to PA

  • Lipid profiling to monitor changes in membrane composition

How does the structure of Synechocystis dgkA compare to other bacterial diacylglycerol kinases?

The structure of diacylglycerol kinase in prokaryotes, including Synechocystis sp., differs significantly from eukaryotic counterparts. DgkA typically forms a homo-trimeric integral membrane protein complex. Unlike mammalian DGKs that contain multiple domains and regulatory regions, bacterial dgkA is more compact and lacks the extensive regulatory domains .

Recent structural studies using magic angle spinning solid-state NMR (ssNMR) spectroscopy have revealed that DgkA forms a well-defined homo-trimeric structure in phospholipid bilayers. This structure differs significantly from those determined in detergent micelles by solution NMR, highlighting the importance of studying membrane proteins in native-like environments .

What expression systems are recommended for producing recombinant Synechocystis dgkA?

For efficient expression of recombinant Synechocystis dgkA, researchers should consider:

Expression SystemAdvantagesLimitationsSpecial Considerations
E. coliHigh yield, well-established protocolsPotential misfolding of membrane proteinsUse specialized strains (C41, C43) or fusion tags
Cell-free systemsAvoids toxicity issues, direct incorporation into liposomesLower yield, higher costAddition of lipids/detergents essential
Synechocystis sp.Native environment, proper foldingLower yield, slower growthConsider glucose-tolerant strains for improved growth

The methodological approach should include optimization of temperature, inducer concentration, and membrane-mimetic environments for protein extraction. For purification, a combination of nickel-affinity chromatography followed by size exclusion chromatography typically yields the best results for structural and functional studies .

What are the recommended methods for assaying dgkA enzymatic activity in vitro?

To measure dgkA activity in vitro, researchers should adopt a multifaceted approach:

  • Radioactive Assay: Using [γ-32P]ATP to monitor the formation of 32P-labeled phosphatidic acid.

  • Coupled Enzyme Assay: Linking ATP consumption to NADH oxidation through pyruvate kinase and lactate dehydrogenase reactions.

  • Interface Recognition Assay: Since dgkA is an interfacial enzyme, proper substrate presentation is critical. Small unilamellar vesicles (SUVs) containing diacylglycerol should be prepared using the following protocol:

    • Dissolve lipids in chloroform/methanol

    • Dry under nitrogen

    • Hydrate in buffer

    • Sonicate or extrude to form SUVs

For kinetic analysis, researchers should vary both substrate concentration and interface composition, as dgkA activity depends on both factors. Careful consideration of lipid composition is essential, as membrane properties significantly affect enzyme binding and catalysis .

How can CRISPR-Cas12a be used for genetic manipulation of dgkA in Synechocystis sp.?

CRISPR-Cas12a offers an efficient system for genome editing in Synechocystis sp. For dgkA manipulation, researchers should follow this methodology:

  • Design an optimized guide RNA (gRNA) specific to the dgkA gene in Synechocystis sp.

  • Construct a replicative plasmid containing both Cas12a and gRNA. RSF1010-based vectors work particularly well in Synechocystis.

  • Introduce the plasmid via conjugation to enable chromosomal cleavage by Cas12a.

  • Supply template DNA via natural transformation for homology-directed repair, achieving the desired genetic modifications.

  • Use sacB-sucrose counter-selection to facilitate plasmid curing after editing.

This system enables various modifications including knockouts, point mutations, and insertions. When targeting dgkA, consider that multiple chromosome copies exist in Synechocystis due to its polyploid nature, requiring special attention to achieve complete segregation of the mutation .

How does membrane composition affect dgkA structure and activity?

Membrane composition critically influences both the structure and activity of dgkA. Research has demonstrated:

  • Structural variations: The structure of DgkA determined in phospholipid bilayers differs significantly from structures resolved in detergent micelles, highlighting environmental sensitivity .

  • Substrate selectivity: Membrane curvature and lipid composition can affect the substrate specificity of diacylglycerol kinases. For instance, other DGK isozymes show higher substrate acyl chain specificity for specific DG molecular species depending on membrane morphology .

  • Activity modulation: The presence of specific anionic phospholipids can enhance dgkA activity by improving enzyme-membrane interactions.

Methodologically, researchers should investigate this relationship by:

  • Reconstituting dgkA in liposomes of varying composition

  • Measuring activity in different membrane environments

  • Using solid-state NMR to determine structural changes in different lipid environments

What are the challenges in determining the high-resolution structure of dgkA in its native membrane environment?

Determining the structure of dgkA in native-like environments presents several methodological challenges:

  • Sample preparation: Maintaining protein stability while preserving the native lipid environment requires careful optimization.

  • Technical limitations: Different structural techniques have inherent limitations:

    • X-ray crystallography requires protein crystallization, often in non-native environments

    • Solution NMR is limited by size constraints

    • Solid-state NMR requires specific isotope labeling strategies

    • Cryo-EM struggles with small membrane proteins

  • Environmental influence: As demonstrated with DgkA, structures determined in different detergent/lipid environments can vary significantly in terms of:

    • Monomeric symmetry

    • Dynamic properties

    • Intermolecular interactions

Recent advances in magic angle spinning solid-state NMR have enabled structure determination of DgkA in phospholipid bilayers, revealing a well-defined homo-trimeric structure that differs from those determined in detergent micelles, highlighting the importance of studying membrane proteins in native-like environments .

How can site-directed mutagenesis inform structure-function relationships in Synechocystis dgkA?

Site-directed mutagenesis offers powerful insights into dgkA structure-function relationships. A systematic approach should include:

  • Identification of catalytic residues: Based on sequence alignment with well-characterized dgkA proteins, target conserved residues likely involved in catalysis.

  • Mutations affecting substrate binding: Modify residues in the proposed DG binding pocket and ATP binding site.

  • Mutations disrupting trimer formation: Target residues at subunit interfaces to determine the importance of oligomerization.

  • Experimental validation: For each mutant, measure:

    • Protein expression and stability

    • Membrane association

    • Enzymatic activity using standardized assays

    • Structural changes using biophysical methods

Data from such studies can be organized as follows:

MutationLocationExpression LevelMembrane AssociationActivity (% of WT)Structural Impact
D30ACatalytic siteNormalNormal<1%Minimal
R15ASubstrate bindingNormalReduced45%Moderate
L80ATrimer interfaceReducedNormal25%Significant

This comprehensive analysis can elucidate the molecular mechanisms underpinning dgkA function in Synechocystis sp. .

How does dgkA from Synechocystis sp. compare functionally to mammalian diacylglycerol kinases?

Synechocystis dgkA differs substantially from mammalian DGKs in several aspects:

  • Structural organization: Bacterial dgkA is a small integral membrane protein that typically forms homotrimers, whereas mammalian DGKs are larger proteins divided into five groups (types I-V) with ten isoforms (α, β, γ, δ, η, κ, ε, ζ, ι, and θ) .

  • Domain architecture: Mammalian DGKs contain regulatory domains such as EF-hand motifs, C1 domains, and pleckstrin homology domains, which are absent in bacterial dgkA .

  • Signaling context: While both enzymes catalyze the same basic reaction (DG → PA), they operate in distinct signaling networks:

    • Mammalian DGKs regulate pathways involved in cancer progression, T-cell function, and neuronal signaling

    • Bacterial dgkA likely functions primarily in membrane homeostasis and stress responses

  • Substrate specificity: Mammalian DGKs typically show preferences for specific DG molecular species, which may differ from bacterial dgkA .

Methodologically, comparative studies should employ standardized activity assays under similar conditions to directly compare kinetic parameters and substrate preferences .

What specific lipid signaling pathways involve dgkA in Synechocystis sp.?

While specific lipid signaling pathways involving dgkA in Synechocystis sp. remain to be fully characterized, potential pathways can be inferred from research on related systems:

  • Stress response pathways: DG and PA likely serve as second messengers during environmental stress responses (light, temperature, osmotic).

  • Cell envelope remodeling: DgkA activity may regulate membrane properties by altering the DG/PA ratio.

  • Photosynthetic membrane dynamics: The phosphorylation of DG by dgkA might influence thylakoid membrane organization.

Methodological approaches to investigate these pathways should include:

  • Transcriptomic analysis under various stress conditions

  • Lipidomic profiling following dgkA mutation/overexpression

  • Proteomic identification of dgkA-interacting partners

  • Physiological phenotyping of dgkA mutants

By integrating these approaches, researchers can construct a comprehensive understanding of dgkA-mediated lipid signaling networks in Synechocystis sp. .

How might dgkA from Synechocystis sp. be engineered for enhanced activity or altered substrate specificity?

Engineering dgkA for enhanced properties presents exciting research opportunities:

  • Rational design strategies:

    • Modify catalytic residues based on structural data

    • Alter membrane-interacting regions to enhance binding

    • Introduce mutations that stabilize the active conformation

  • Directed evolution approaches:

    • Develop high-throughput screening systems in Synechocystis sp.

    • Use error-prone PCR to generate variant libraries

    • Select for variants with desired properties under specific conditions

  • Synthetic biology applications:

    • Engineer dgkA as part of synthetic lipid biosynthesis pathways

    • Create chimeric enzymes combining domains from different sources

    • Develop optogenetic or chemically-inducible dgkA variants

The CRISPR-Cas12a system optimized for Synechocystis sp. provides an excellent platform for implementing these engineering strategies directly in the cyanobacterial genome .

What role might dgkA play in cyanobacterial biotechnology applications?

DgkA has significant potential in cyanobacterial biotechnology:

  • Biofuel production: Engineering dgkA activity could redirect carbon flux toward lipid production, enhancing biofuel yields in engineered Synechocystis strains.

  • Membrane stress resistance: Modulating dgkA expression might improve cyanobacterial tolerance to industrial conditions.

  • Photosynthetic efficiency: DgkA-mediated changes in membrane composition could optimize photosynthetic apparatus organization.

  • Biosensor development: DgkA activity could serve as a readout for specific environmental conditions or stresses.

Methodological approaches should combine genome editing, synthetic biology, and systems biology to integrate dgkA modifications with other metabolic engineering strategies. The efficient multiplex genome editing methods developed for Synechocystis sp. using CRISPR-Cas12a will be particularly valuable for these applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.