Recombinant Synechocystis sp. Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Applications in Research

  1. Lipoprotein Biosynthesis Studies:

    • Used to investigate diacylglyceryl transferase activity in cyanobacteria .

    • Essential for validating Lgt inhibitors targeting Gram-negative pathogens .

  2. Metabolic Engineering:

    • Fused to thioesterases in Synechocystis to localize fatty acid hydrolysis at the membrane-cytoplasm interface, enhancing lipid production .

  3. Antibiotic Development:

    • Serves as a template for designing inhibitors against homologous Lgt enzymes in pathogens like Acinetobacter baumannii and E. coli .

Key Research Findings

  • Essentiality: Lgt depletion in E. coli causes outer membrane destabilization and cell death, confirming its critical role .

  • Inhibitor Resistance: Unlike downstream lipoprotein pathway enzymes (e.g., LspA), Lgt inhibition remains effective even in lpp (major outer membrane lipoprotein) deletion strains, highlighting its unique vulnerability .

  • Crosslinking Efficiency: Diacylglyceryl modification by Lgt enhances peptidoglycan linkage of lipoproteins like Lpp, critical for cell envelope integrity .

Comparative Analysis with Homologs

FeatureSynechocystis sp. LgtE. coli Lgt
Length (aa)283291
Sequence Identity23.2%100% (reference)
Transmembrane Domains77
Catalytic MotifConserved TM4 lipoboxConserved TM4 lipobox
Essential for GrowthPresumedYes

Future Directions

  • Structural Studies: High-resolution crystallography of Synechocystis Lgt to elucidate species-specific adaptations.

  • Biotechnological Applications: Optimizing Lgt fusion systems for synthetic biology in cyanobacteria .

  • Therapeutic Targeting: Developing broad-spectrum Lgt inhibitors using conserved active-site residues .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; sll1187; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
lgt
Target Protein Sequence
MIEQIFFGQFQSPGPVMFQIGGFALRWYGFLIASAVIIGLNLCQWLGQKRGINPDLFNDL VIWLVVAAIPSARLYYVAFEWPRYAQHWLNIFAIWQGGIAIHGALIGGTIAILVFSRYHQ LSFWNLLDVLTPAVILGQAIGRWGNFFNSEAFGAPTNLPWKLYIPFANRPLNLTSYAYFH PTFLYESVWNLGIFAILIALFFYGLRNPEKIKTGTITCVYLIGYSLGRVWIEGLRLDSLM LGPLRIAQVVSITLVLLGTAGIVWLYLLQKNLPDWSERKLVKN
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Lgt in Synechocystis sp.?

Lipoprotein diacylglyceryl transferase (Lgt) catalyzes the critical first step in the biogenesis pathway of bacterial lipoproteins, which are essential for cellular function in Gram-negative bacteria including Synechocystis. Lgt specifically transfers a diacylglyceryl moiety from phosphatidylglycerol to the cysteine residue in the lipobox of prolipoproteins, initiating their maturation process. This modification anchors the lipoproteins to the membrane, which is essential for maintaining outer membrane integrity in Gram-negative bacteria . In cyanobacteria like Synechocystis, this process is particularly important as the organism possesses a complex membrane system including thylakoid membranes for photosynthesis, making proper lipoprotein processing vital for both membrane structure and function.

Research has demonstrated that depletion of Lgt in Gram-negative bacteria such as E. coli leads to permeabilization of the outer membrane and increased sensitivity to serum killing and antibiotics, suggesting similar critical functions likely exist in Synechocystis . Given the important roles that bacterial lipoproteins play in growth, stress response, and pathogenesis in other species, understanding Lgt function in Synechocystis has implications for both basic cyanobacterial biology and biotechnological applications.

How can Lgt from Synechocystis be recombinantly expressed?

Recombinant expression of Lgt from Synechocystis typically employs self-replicative vectors suitable for cyanobacterial transformation. The Standard European Vector Architecture (SEVA) repository provides several validated vectors that can be used for transformation of Synechocystis sp. PCC 6803 . For Lgt expression, consider the following protocol:

  • Vector selection: Choose an appropriate SEVA plasmid such as pSEVA251, pSEVA351, or pSEVA451, which have been validated for use in Synechocystis .

  • Promoter choice: Select a promoter with appropriate expression strength. Characterized promoters in Synechocystis exhibit a wide range of activities compared to the reference promoter PrnpB. For regulated expression, several promoters that can be efficiently repressed are available .

  • Transformation procedure: Transform Synechocystis via natural transformation by:

    • Growing cells to an OD730 ≈ 0.5

    • Harvesting by centrifugation (10 min at 3850 g)

    • Resuspending in BG11 to a final OD730 ≈ 2.5

    • Incubating with the plasmid DNA (final concentration 20 μg/ml) for 5 hours in light at 25°C

    • Spreading on ImmobilonTM-NC membranes resting on solid BG11 plates

    • Transferring to selective plates after 24 hours

  • Culture conditions: Maintain transformed strains in BG11 medium at 30°C under appropriate light conditions (either continuous light or a 12h light/12h dark regimen) at 100-150 rpm in an orbital shaker .

One advantage of using Synechocystis for recombinant protein expression is its ability to grow photoheterotrophically using glucose, which allows for more flexible culture conditions compared to obligate photoautotrophs like S. elongatus .

What methods are used to verify successful transformation and expression of recombinant Lgt?

Verifying successful transformation and expression of recombinant Lgt in Synechocystis requires multiple complementary approaches:

  • PCR verification: Amplify the introduced gene from genomic DNA extracts of transformed cells to confirm the presence of the lgt gene.

  • Protein expression confirmation: Use SDS-PAGE and western blot analysis to detect the expressed protein. Cell-free extracts can be obtained by sonication as described by Pinto et al., then separated by electrophoresis on 12% SDS-polyacrylamide gels and visualized with Coomassie Brilliant Blue or specific antibodies .

  • Functional complementation: If working with an lgt deletion mutant, functional complementation can be assessed by evaluating whether the introduced gene restores the wild-type phenotype. For example, similar to the approach used for ggpS, a growth experiment comparing wild-type, deletion mutant, and complemented strains under various stress conditions would demonstrate functional restoration .

  • Microscopy: If using a fluorescent tag, confocal microscopy can be employed to visualize protein localization. Settings should be adjusted to minimize Synechocystis autofluorescence. For GFP-tagged proteins, collect emission between 500-540 nm after excitation at 488 nm, while cyanobacterial autofluorescence can be collected between 640-680 nm after excitation at 633 nm .

  • Enzymatic activity assay: For Lgt specifically, an in vitro biochemical assay measuring the transfer of the diacylglyceryl moiety from phosphatidylglycerol to a substrate prolipoprotein can be performed to confirm enzymatic activity .

How does Lgt from Synechocystis differ structurally from Lgt in other bacterial species?

While the search results don't provide specific structural information about Synechocystis Lgt, comparative analysis with other bacterial species provides insights:

Lgt is a membrane protein with multiple transmembrane domains that catalyzes the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the cysteine residue in the lipobox of prolipoproteins. In most Gram-negative bacteria including E. coli, Lgt contains conserved residues essential for catalytic activity and substrate binding. The phosphatidylglycerol binding site is particularly conserved across bacterial species .

Synechocystis, as a cyanobacterium, possesses a more complex membrane system than typical Gram-negative bacteria, including thylakoid membranes for photosynthesis. This might influence the localization and possibly the structure-function relationship of Lgt in this organism. While the catalytic mechanism is likely conserved, adaptations specific to the cyanobacterial membrane architecture may exist.

To definitively characterize structural differences, researchers should consider:

  • Homology modeling based on known bacterial Lgt structures

  • Sequence alignment analysis focusing on conserved catalytic residues

  • Experimental structural determination methods such as X-ray crystallography or cryo-EM

The high conservation of the phosphatidylglycerol binding site suggested by inhibitor studies in other bacteria indicates this region may be structurally similar in Synechocystis as well .

What are the optimal conditions for measuring Lgt enzymatic activity in vitro?

Based on research with Lgt from other bacterial species, the following protocol can be adapted for measuring Synechocystis Lgt enzymatic activity:

Enzyme Preparation:

  • Express recombinant Lgt using an appropriate vector system in Synechocystis or a heterologous host

  • Isolate membrane fractions containing Lgt

  • Solubilize using a mild detergent (e.g., n-dodecyl-β-D-maltoside)

  • Purify using affinity chromatography if a tag is incorporated

Activity Assay Conditions:

  • Buffer system: Typically phosphate buffer (pH 7.0-8.0) supplemented with divalent cations (Mg2+)

  • Substrate preparation:

    • Phosphatidylglycerol (PG) as the lipid donor

    • Synthetic peptide containing the lipobox consensus sequence as the acceptor

  • Detection method: Either radiolabeled substrates or mass spectrometry to quantify the transfer of the diacylglyceryl moiety

  • Inhibitor studies: Include known Lgt inhibitors as controls to validate the assay specificity

Data Analysis:

  • Calculate initial rates at varying substrate concentrations

  • Determine kinetic parameters (Km, Vmax, kcat)

  • Compare activity under different conditions (pH, temperature, ionic strength)

The assay can be validated by confirming that the recombinant enzyme exhibits similar inhibition profiles with known Lgt inhibitors as observed in studies with E. coli or A. baumannii Lgt .

How can gene knockout and complementation experiments be designed to study Lgt function in Synechocystis?

A robust experimental design for studying Lgt function through knockout and complementation involves the following steps:

Lgt Knockout Strategy:

  • Construct an integrative plasmid containing chromosomal regions flanking the lgt gene, similar to the approach described for ggpS deletion:

    • Amplify 5' and 3' flanking regions of lgt

    • Fuse fragments by overlap PCR

    • Clone into an appropriate vector (e.g., pGEM-T Easy)

    • Insert a selection cassette (e.g., nptII for kanamycin resistance)

  • Transform Synechocystis via natural transformation:

    • Grow cells to OD730 ≈ 0.5

    • Harvest and resuspend to OD730 ≈ 2.5

    • Incubate with the knockout plasmid

    • Plate on selective media

    • Increase antibiotic concentration gradually to ensure complete segregation

  • Verify complete segregation by Southern blot or PCR analysis

Complementation Strategy:

  • Clone the lgt gene under a suitable promoter (e.g., PrnpB or one of the characterized promoters) into a SEVA replicative vector

  • Transform the knockout strain with this complementation construct

  • Select transformants on appropriate antibiotics

  • Verify expression using western blot

Phenotypic Analysis:

  • Growth experiments comparing wild-type, knockout, and complemented strains under various conditions (different temperatures, salt concentrations, light regimens)

  • Membrane integrity assays to assess outer membrane permeabilization

  • Antibiotic sensitivity testing to determine if lgt deletion increases susceptibility

  • Proteomic analysis to identify affected lipoproteins

Controls:

  • Include a strain harboring the empty vector to control for vector effects

  • Monitor plasmid maintenance in complemented strains by regular PCR verification

This experimental approach allows for comprehensive functional characterization of Lgt in Synechocystis while controlling for potential confounding factors.

What are common challenges in expressing recombinant Lgt in Synechocystis and how can they be addressed?

Researchers working with recombinant Lgt expression in Synechocystis commonly encounter several challenges that require specific troubleshooting approaches:

Challenge 1: Membrane Protein Expression

  • Issue: As a membrane protein, Lgt may cause toxicity when overexpressed

  • Solution: Use tightly regulated promoters with inducible expression systems. Several efficiently repressed promoters have been characterized in Synechocystis, which could be used to control expression levels . Consider using the LacI repressor system with one of the characterized LacI-repressible promoters.

Challenge 2: Plasmid Stability

  • Issue: Loss of expression plasmid without selective pressure

  • Solution: The SEVA replicative vectors have demonstrated good stability in Synechocystis, with the vast majority of cells retaining the plasmid even in the absence of selective pressure . Regular monitoring of plasmid retention through PCR or fluorescent markers is recommended. Maintaining low antibiotic pressure may help without causing significant growth inhibition.

Challenge 3: Protein Solubilization and Purification

  • Issue: Difficult extraction of functional membrane proteins

  • Solution: Optimize membrane fraction isolation and detergent selection. Test multiple detergents (DDM, LMNG, digitonin) at various concentrations. Consider using a GFP-fusion to monitor protein folding and extraction efficiency.

Challenge 4: Codon Usage Bias

  • Issue: Suboptimal translation due to codon differences

  • Solution: Optimize the lgt gene sequence for Synechocystis codon usage. Analysis of highly expressed Synechocystis genes can inform codon optimization strategies.

Challenge 5: Growth Conditions

  • Issue: Suboptimal growth affecting protein yield

  • Solution: Leverage Synechocystis' ability to grow photoheterotrophically by supplementing media with glucose, which allows more flexible culture conditions . Optimize light intensity and cycle for protein expression rather than just biomass production.

How can researchers design experiments to investigate Lgt inhibition in Synechocystis?

Designing experiments to investigate Lgt inhibition in Synechocystis requires a multifaceted approach:

1. Biochemical Inhibition Assays:

  • Express and purify recombinant Synechocystis Lgt

  • Establish an in vitro enzymatic assay measuring diacylglyceryl transfer

  • Screen potential inhibitors at various concentrations to determine IC50 values

  • Investigate the mechanism of inhibition (competitive vs. non-competitive)

2. Whole-Cell Inhibition Studies:

  • Determine minimal inhibitory concentrations (MICs) of identified Lgt inhibitors against Synechocystis

  • Assess dose-dependent growth inhibition curves

  • Monitor membrane integrity using fluorescent dyes or reporter systems

  • Compare inhibitor effectiveness between wild-type and strains with altered Lgt expression levels

3. Resistance Development Assessment:

  • Perform long-term exposure experiments to assess resistance development

  • Sequence lgt gene from any resistant strains to identify potential mutations

  • Create targeted mutations in conserved regions to validate the binding site, similar to the approach used for creating period mutants in the kai genes

4. Phenotypic Characterization:

  • Assess changes in outer membrane permeability using fluorescent dyes

  • Determine if inhibition increases sensitivity to antibiotics or environmental stressors

  • Analyze changes in lipoprotein profiles using proteomic approaches

5. Comparative Studies:

  • Compare inhibitor efficacy between Synechocystis Lgt and Lgt from other bacterial species like E. coli and A. baumannii

  • Investigate if resistance mechanisms observed in other bacteria apply to Synechocystis

This systematic approach allows for comprehensive characterization of Lgt inhibition while providing insights into potential species-specific differences in inhibitor efficacy and resistance mechanisms.

What controls should be included when studying Lgt function in Synechocystis?

When studying Lgt function in Synechocystis, a comprehensive set of controls is essential to ensure experimental validity and interpretability:

Genetic Controls:

  • Wild-type strain: Essential baseline for all experiments

  • Empty vector control: When using plasmid-based expression, include strains harboring the empty vector to account for vector-related effects

  • Complementation control: For knockout studies, include both positive (wild-type gene) and negative (non-functional mutant) complementation

  • Unrelated gene knockout: Include a knockout of an unrelated gene to distinguish specific Lgt effects from general effects of genetic manipulation

Expression Controls:

  • Reporter gene fusions: Use GFP or other reporter gene fusions to monitor expression and localization

  • Western blot standards: Include purified recombinant protein standards when quantifying expression levels

  • Multiple clones: Analyze multiple independent transformants to account for clone-to-clone variation

  • Time-course sampling: Monitor expression at multiple time points to account for temporal variations

Phenotypic Controls:

  • Growth condition controls: Test multiple growth conditions (light/dark cycles, temperature, media composition) to identify condition-dependent effects

  • Stress response controls: Include positive controls for membrane stress when assessing membrane integrity

  • Chemical inhibitor controls: When using inhibitors, include both known Lgt inhibitors and unrelated inhibitors as positive and negative controls

Technical Controls:

  • No-template controls: For PCR verification

  • Autofluorescence control: Critical for microscopy to distinguish protein fluorescence from native cyanobacterial autofluorescence

  • Loading controls: For western blots and other protein analyses

  • Mixed culture competition experiments: To assess fitness effects under different environmental conditions

These controls help distinguish true biological effects from technical artifacts and provide critical context for interpreting experimental results related to Lgt function.

How should researchers analyze and interpret changes in membrane integrity resulting from Lgt manipulation?

Analysis and interpretation of membrane integrity changes resulting from Lgt manipulation requires multiple complementary approaches:

Quantitative Assessment Methods:

  • Fluorescent Dye Uptake: Measure uptake of membrane-impermeable dyes (e.g., SYTOX Green, propidium iodide)

    • Calculate percentage of permeable cells via flow cytometry

    • Establish dose-response curves if using inhibitors

    • Analyze kinetics of dye uptake over time

  • Antibiotic Sensitivity Profiling:

    • Determine MICs for various antibiotics in wild-type vs. Lgt-manipulated strains

    • Calculate fold-change in sensitivity and generate the following comparison table:

    Antibiotic ClassWild-type MIC (μg/ml)Lgt-depleted MIC (μg/ml)Fold Changep-value
    β-lactamsXYY/Xp
    AminoglycosidesXYY/Xp
    MacrolidesXYY/Xp
    TetracyclinesXYY/Xp
  • Serum Sensitivity Assay:

    • Expose cells to increasing concentrations of serum

    • Plot survival curves

    • Calculate LD50 values

Microscopic Analysis:

  • Electron Microscopy: Quantify ultrastructural changes in membrane architecture

    • Measure membrane thickness at multiple points

    • Assess membrane vesiculation events

    • Quantify differences in membrane density

  • Confocal Microscopy: For fluorescently tagged membrane components

    • Use settings optimized to minimize Synechocystis autofluorescence

    • Collect GFP emission between 500-540 nm after excitation at 488 nm

    • Collect cyanobacterial autofluorescence between 640-680 nm after excitation at 633 nm

Interpretation Framework:

  • Direct vs. Indirect Effects: Distinguish primary effects of Lgt deficiency from secondary responses

  • Temporal Progression: Analyze early vs. late changes to identify causative relationships

  • Lipoprotein-Specific Effects: Correlate membrane changes with alterations in specific lipoproteins

  • Comparative Analysis: Compare effects in Synechocystis with known effects in E. coli and A. baumannii

Researchers should consider that, as demonstrated in E. coli, Lgt depletion leads to outer membrane permeabilization and increased sensitivity to serum killing and antibiotics . Similar phenotypes in Synechocystis would support conserved functions, while differences might indicate cyanobacteria-specific adaptations related to their unique photosynthetic membrane systems.

What statistical approaches are appropriate for analyzing Lgt enzymatic activity data?

When analyzing Lgt enzymatic activity data from Synechocystis, researchers should employ the following statistical approaches:

For Kinetic Parameter Determination:

  • Non-linear regression analysis: Use for fitting enzyme kinetic data to appropriate models (Michaelis-Menten, allosteric, etc.)

    • Calculate Km, Vmax, and kcat values with 95% confidence intervals

    • Compare goodness-of-fit between different kinetic models using AIC or BIC criteria

  • Lineweaver-Burk or other transformations: Use as secondary analyses to visualize inhibition patterns

    • Apply weighted regression to minimize distortion from reciprocal plotting

    • Calculate Ki values for competitive inhibitors

For Comparative Analyses:

  • ANOVA with post-hoc tests: When comparing multiple conditions or mutants

    • Use Tukey's HSD for all pairwise comparisons

    • Apply Dunnett's test when comparing multiple treatments to a control

  • Student's t-test: For direct comparison between two conditions

    • Use paired t-tests for before/after comparisons on the same enzyme preparation

    • Apply Welch's correction for samples with unequal variances

For Inhibitor Studies:

  • Four-parameter logistic regression: For determination of IC50 values

    • Calculate 95% confidence intervals for all IC50 values

    • Generate dose-response curves with appropriate Hill slopes

  • Dixon plots: For distinguishing between competitive and non-competitive inhibition

    • Plot 1/velocity against inhibitor concentration at different substrate concentrations

    • Determine inhibition constants and mechanisms

For Reproducibility Assessment:

  • Coefficient of variation (CV): Calculate for technical and biological replicates

    • Establish acceptable CV thresholds based on assay type

    • Report both intra-assay and inter-assay CV values

  • Concordance correlation coefficient: For assessing agreement between independent replicates or different analytical methods

Data Presentation Standards:

  • Always report sample sizes, p-values, and effect sizes

  • Include error bars representing standard deviation or standard error as appropriate

  • Clearly state null hypotheses and significance thresholds prior to analysis

  • Consider applying false discovery rate correction for multiple comparisons

These statistical approaches provide a robust framework for analyzing enzymatic data while accounting for the variability inherent in biological systems and ensuring reliable interpretation of results.

How can researchers integrate transcriptomic and proteomic data to understand global effects of Lgt manipulation?

Integrating transcriptomic and proteomic data provides a comprehensive understanding of the global effects of Lgt manipulation in Synechocystis. Here's a methodological framework:

Data Collection Strategy:

  • Experimental Design:

    • Compare wild-type, Lgt-depleted, and complemented strains

    • Include time-course sampling to capture dynamic responses

    • Test multiple environmental conditions (standard, stress conditions)

  • Transcriptomics:

    • Perform RNA-Seq with sufficient biological replicates (minimum n=3)

    • Include spike-in controls for normalization

    • Target sequencing depth of >20 million reads per sample

  • Proteomics:

    • Conduct both whole-cell and membrane-specific proteomic analyses

    • Use stable isotope labeling for quantitative comparisons

    • Apply specialized methods for membrane protein extraction

Integration Framework:

  • Multi-omics Data Processing:

    • Normalize both datasets independently using appropriate methods

    • Identify differentially expressed genes and proteins

    • Generate the following integrated data table:

    Gene IDProteinLog₂FC TranscriptLog₂FC ProteinPredicted LipoproteinMembrane Fraction
    slrXXXXProtAX.XXY.YYYes/NoOM/IM/Both
    sllXXXXProtBX.XXY.YYYes/NoOM/IM/Both
  • Correlation Analysis:

    • Calculate global transcript-protein correlation coefficients

    • Perform correlation analysis for specific functional categories

    • Identify discordant genes (significant change at only one level)

  • Pathway Enrichment:

    • Apply Gene Ontology enrichment analysis to both datasets

    • Use KEGG pathway mapping for functional interpretation

    • Identify differentially regulated biological processes

Advanced Integration Methods:

  • Network Analysis:

    • Construct gene and protein co-expression networks

    • Identify network modules affected by Lgt manipulation

    • Calculate network centrality measures to identify key regulators

  • Temporal Dynamics:

    • Apply time-series analysis methods (e.g., DREM, WGCNA)

    • Identify early vs. late response genes/proteins

    • Model regulatory cascades initiated by Lgt depletion

  • Machine Learning Approaches:

    • Use supervised learning to identify features predictive of Lgt-dependent regulation

    • Apply dimensionality reduction techniques to visualize multi-omics data

    • Develop predictive models for lipoprotein processing

Biological Interpretation Framework:

  • Distinguish direct effects (unprocessed lipoproteins) from indirect responses

  • Identify compensatory mechanisms activated upon Lgt dysfunction

  • Compare results with known lipoprotein processing pathways in model organisms

  • Correlate molecular changes with observed phenotypic effects

By systematically integrating transcriptomic and proteomic data, researchers can develop a comprehensive understanding of how Lgt manipulation affects cellular physiology beyond just lipoprotein processing, revealing systems-level adaptations and potential secondary targets for antimicrobial development.

What are promising research directions for studying Lgt function in cyanobacterial photosynthesis?

Several promising research directions for studying Lgt function in cyanobacterial photosynthesis emerge from current knowledge:

Thylakoid Membrane Organization:

  • Investigate the role of Lgt-processed lipoproteins in thylakoid membrane biogenesis and organization

  • Examine how Lgt depletion affects photosystem assembly and arrangement

  • Study the interaction between lipoproteins and photosynthetic complexes

This direction is particularly relevant given Synechocystis's complex membrane system including thylakoid membranes for photosynthesis, which differs from typical Gram-negative bacteria .

Photosynthetic Efficiency Under Stress:

  • Examine how Lgt-dependent lipoproteins contribute to photosynthetic performance under various stress conditions

  • Measure parameters such as quantum yield, electron transport rate, and non-photochemical quenching in wild-type versus Lgt-depleted strains

  • Investigate if certain lipoproteins play roles in photoprotection mechanisms

Circadian Regulation of Photosynthesis:

  • Explore potential links between Lgt-processed lipoproteins and circadian regulation of photosynthesis

  • Determine if any photosynthesis-related lipoproteins show circadian expression patterns

  • Investigate whether Lgt itself is under circadian control in Synechocystis, leveraging the organism's well-characterized circadian system

Comparative Analysis Across Cyanobacterial Species:

  • Compare Lgt function between obligate photoautotrophs like S. elongatus and facultative photoheterotrophs like Synechocystis

  • Identify species-specific adaptations in lipoprotein processing related to different photosynthetic lifestyles

  • Examine evolutionary conservation of photosynthesis-related lipoproteins

Synthetic Biology Applications:

  • Engineer Lgt-processed lipoproteins as anchors for artificial photosynthetic complexes

  • Design modified lipoproteins to enhance photosynthetic efficiency

  • Develop tunable expression systems using the characterized promoter sets from Synechocystis

These research directions would benefit from the expanded toolbox for Synechocystis, including validated replicative vectors and characterized promoters , as well as the organism's ability to grow photoheterotrophically, which allows for more flexible experimental conditions .

How can researchers effectively use Synechocystis Lgt for structure-based drug design?

Researchers can effectively use Synechocystis Lgt for structure-based drug design through the following comprehensive approach:

Structural Characterization:

  • Protein Expression and Purification:

    • Express recombinant Lgt using optimized SEVA vectors in Synechocystis

    • Incorporate purification tags that minimally affect function

    • Optimize detergent conditions for membrane protein solubilization

    • Utilize nanodiscs or other membrane mimetics for stabilization

  • Structure Determination:

    • Apply X-ray crystallography with lipidic cubic phase techniques

    • Alternatively, use cryo-EM for membrane protein structure determination

    • Consider hybrid approaches combining computational modeling with experimental constraints

  • Binding Site Analysis:

    • Identify catalytic residues through sequence alignment with characterized Lgt enzymes

    • Map conservation across bacterial species to identify unique features of cyanobacterial Lgt

    • Use molecular dynamics simulations to characterize binding pocket dynamics

Computational Drug Design:

  • Virtual Screening:

    • Create a pharmacophore model based on known Lgt inhibitors

    • Perform high-throughput virtual screening against compound libraries

    • Apply multiple scoring functions to rank hits

  • Fragment-Based Design:

    • Identify small molecule fragments that bind to specific regions of Lgt

    • Use computational methods to grow or link fragments

    • Optimize binding affinity and selectivity through iterative design

  • Molecular Dynamics Simulations:

    • Assess ligand binding stability and induced conformational changes

    • Calculate binding free energies using methods like MM/PBSA

    • Investigate water networks and potential water-mediated interactions

Experimental Validation:

  • Binding Assays:

    • Develop thermal shift assays to measure ligand binding

    • Use surface plasmon resonance or isothermal titration calorimetry for binding kinetics

    • Apply hydrogen-deuterium exchange mass spectrometry to map binding sites

  • Enzymatic Assays:

    • Establish high-throughput Lgt activity assays for inhibitor screening

    • Determine inhibition mechanisms and constants

    • Analyze structure-activity relationships of inhibitor series

  • Cellular Assays:

    • Test inhibitor effects on Synechocystis growth and membrane integrity

    • Compare with effects on other bacterial species to assess selectivity

    • Evaluate resistance development potential through long-term exposure studies

Structure-Based Optimization:

  • Create targeted libraries based on initial hits

  • Apply iterative optimization cycles combining computational and experimental data

  • Optimize for properties beyond potency (solubility, selectivity, resistance barrier)

This approach takes advantage of novel Lgt inhibitors that have been identified and validated against other bacterial species , while expanding their application to cyanobacterial targets with potential specificity for photosynthetic organisms.

What ethical considerations should researchers address when developing Lgt inhibitors as potential antimicrobials?

Researchers developing Lgt inhibitors as potential antimicrobials should address several ethical considerations throughout the research and development process:

Scientific Integrity and Responsible Research:

  • Rigorous Experimental Design: Ensure studies include appropriate controls and statistical power to produce reliable results .

  • Transparent Reporting: Disclose all methods, data (including negative results), and potential conflicts of interest.

  • Resource Sharing: Make research tools, such as characterized vectors and promoters, available to the scientific community .

  • Reproducibility: Validate findings across different laboratories and experimental conditions.

Environmental Impact Assessment:

  • Ecotoxicology Studies: Evaluate effects on beneficial cyanobacteria and microalgae in environmental samples.

  • Biodegradation Analysis: Determine persistence of inhibitors in aquatic environments.

  • Ecosystem Effects: Assess potential disruption of microbial communities and ecological functions.

  • Mitigation Strategies: Develop containment protocols for laboratory and clinical testing phases.

Antimicrobial Resistance Considerations:

  • Resistance Development Monitoring: Establish protocols to detect and characterize potential resistance mechanisms .

  • Combination Therapy Evaluation: Assess synergistic potential with existing antibiotics to minimize resistance.

  • Stewardship Planning: Develop guidelines for appropriate use if compounds advance to clinical applications.

  • Surveillance Systems: Design monitoring programs to track effectiveness and resistance emergence.

Ethical Use Framework:

  • Target Spectrum Analysis: Ensure specificity for pathogenic bacteria while minimizing effects on beneficial microbiota.

  • Priority Setting: Consider focusing on critical unmet needs (e.g., multidrug-resistant pathogens).

  • Access Planning: Develop strategies to ensure equitable access to any resulting therapies.

  • Patient Safety Protocols: Establish rigorous safety assessment frameworks for clinical development.

Collaborative Ethics:

  • Interdisciplinary Engagement: Include ethicists, environmental scientists, and public health experts in research planning.

  • Stakeholder Consultation: Engage with patient advocacy groups and regulatory bodies early in development.

  • Global Health Considerations: Address potential impacts on healthcare systems in various global settings.

  • Indigenous Knowledge Respect: Acknowledge traditional uses of cyanobacteria when relevant.

These ethical considerations should be integrated throughout the research process, from initial target validation through advanced development, ensuring that Lgt inhibitor research maximizes potential benefits while minimizing risks to individuals, communities, and ecosystems.

What are the best growth and cultivation conditions for maximizing recombinant Lgt expression in Synechocystis?

Optimizing growth and cultivation conditions for maximizing recombinant Lgt expression in Synechocystis requires attention to multiple parameters:

Media Composition:

  • Base Medium: Standard BG11 medium provides essential nutrients for robust growth .

  • Carbon Source Enhancement: Leverage Synechocystis' unique ability to grow photoheterotrophically by supplementing with glucose (5-10 mM), which can improve growth rates and potentially increase protein yields compared to photoautotrophic conditions .

  • Nitrogen Source: Test various nitrogen sources (nitrate, ammonium, urea) to optimize for protein expression rather than just biomass production.

  • Trace Elements: Ensure adequate supply of iron, manganese, and zinc, which are essential cofactors for many cellular processes.

Physical Parameters:

  • Temperature Regulation:

    • Maintain cultures at 30°C, which is standard for Synechocystis growth .

    • Consider temperature shifts (e.g., lowering to 25°C after induction) to improve protein folding.

  • Light Conditions:

    • Light intensity: 20-25 μE/m²/s provides good growth while minimizing photooxidative stress .

    • Light cycle: Test both continuous light and 12h light/12h dark regimens to determine optimal conditions for your specific construct .

    • Light quality: Compare white light with specific wavelengths (red/blue) that might enhance expression.

  • Aeration and Mixing:

    • Maintain cultures at 100-150 rpm in an orbital shaker for adequate gas exchange .

    • Consider supplementation with 1-5% CO₂ for enhanced growth.

Expression Parameters:

  • Vector Selection:

    • Use validated self-replicative vectors from the SEVA repository that have demonstrated stability in Synechocystis .

    • Consider vector copy number effects on expression levels.

  • Promoter Optimization:

    • Select from characterized promoters with appropriate strength.

    • For membrane proteins like Lgt, moderate promoters often perform better than very strong ones.

    • Consider inducible systems for temporal control of expression .

  • Harvest Timing:

    • Determine optimal expression phase (early exponential, mid-exponential, or stationary).

    • Monitor culture density using OD₇₃₀ measurements .

Scale-up Considerations:

  • Culture Volume Progression:

    • Start with small volumes (25-50 ml in 100 ml flasks) .

    • Scale up gradually to maintain consistent growth parameters.

  • Photobioreactor Design:

    • Ensure even light distribution throughout the culture.

    • Maintain consistent temperature and mixing across scales.

This optimization framework takes advantage of Synechocystis' unique characteristics as a photosynthetic organism with the ability to grow heterotrophically, providing flexibility in cultivation strategies not available with obligate photoautotrophs .

How can researchers design fusion constructs to study Lgt localization and dynamics in Synechocystis?

Designing effective fusion constructs to study Lgt localization and dynamics in Synechocystis requires careful consideration of multiple factors:

Fusion Protein Design:

  • Tag Selection:

    • Fluorescent proteins: GFP variants optimized for cyanobacterial expression; consider photoconvertible fluorophores like mEos for pulse-chase experiments

    • Affinity tags: His₆, FLAG, or Strep-tag for purification and immunodetection

    • Enzyme tags: HaloTag or SNAP-tag for specific labeling with synthetic fluorophores

  • Fusion Position:

    • For membrane proteins like Lgt, C-terminal fusions are often preferred to avoid disrupting signal sequences

    • Consider creating both N- and C-terminal fusions to compare functionality

    • For multi-spanning membrane proteins, insertion of tags in permissive loops may be necessary

  • Linker Design:

    • Use flexible glycine-serine linkers (GGGGS)ₙ to minimize interference with folding

    • Test multiple linker lengths (5-20 amino acids) to optimize function

    • Consider rigid linkers if spatial separation is critical

Vector Construction:

  • Promoter Selection:

    • Use characterized promoters with appropriate expression levels

    • For dynamic studies, consider inducible systems allowing temporal control

    • For native expression levels, use the endogenous lgt promoter

  • Replicative vs. Integrative Approaches:

    • SEVA replicative vectors allow faster construct screening

    • Chromosomal integration ensures stable expression and consistent copy number

    • Consider dual approaches: initial screening with replicative vectors followed by integration of validated constructs

Validation Methods:

  • Functionality Testing:

    • Complement an lgt deletion strain to confirm fusion protein functionality

    • Assess growth rates and membrane integrity in complemented strains

    • Measure enzymatic activity of the fusion protein compared to wild-type

  • Localization Verification:

    • Use confocal microscopy with settings optimized to minimize Synechocystis autofluorescence

    • Collect GFP emission between 500-540 nm after excitation at 488 nm

    • Collect cyanobacterial autofluorescence between 640-680 nm after excitation at 633 nm

  • Controls:

    • Include free fluorescent protein expression as a localization control

    • Use known membrane protein fusions as comparison standards

    • Implement organelle-specific markers to confirm subcellular localization

Advanced Dynamic Studies:

  • FRAP (Fluorescence Recovery After Photobleaching):

    • Measure mobility of Lgt fusion proteins in the membrane

    • Calculate diffusion coefficients and mobile fractions

    • Compare dynamics under different environmental conditions

  • Pulse-Chase Approaches:

    • Use inducible promoters for temporal expression control

    • Apply photoconvertible fluorophores to track protein cohorts

    • Quantify protein turnover rates and half-life

  • Protein-Protein Interaction Studies:

    • Implement FRET pairs to study interactions with substrate proteins

    • Apply split-GFP complementation to identify interaction partners

    • Use proximity labeling approaches (BioID, APEX) to map the Lgt interactome

These approaches allow for comprehensive characterization of Lgt localization and dynamics, providing insights into its membrane distribution, mobility, and interactions in the context of Synechocystis' complex membrane system.

What specialized techniques are required for analyzing lipoprotein modifications in Synechocystis?

Analyzing lipoprotein modifications in Synechocystis requires specialized techniques that address the unique challenges of identifying and characterizing lipid modifications on proteins:

Sample Preparation Methods:

  • Membrane Fractionation:

    • Separate outer membrane, plasma membrane, and thylakoid membrane fractions using sucrose density gradients

    • Verify fraction purity using marker proteins for each membrane compartment

    • Extract membrane proteins using detergents optimized for lipoproteins (e.g., Triton X-114 phase separation)

  • Enrichment Strategies:

    • Metabolic labeling with alkyne/azide-modified fatty acids for click chemistry enrichment

    • Hydrophobic interaction chromatography to select lipidated proteins

    • Immobilized metal affinity chromatography for His-tagged recombinant lipoproteins

Mass Spectrometry Approaches:

  • Specialized Digestion Protocols:

    • Perform multiple enzyme digestions (trypsin, Glu-C, chymotrypsin) to improve coverage

    • Implement on-membrane digestion for poorly soluble lipoproteins

    • Use chemical cleavage methods (CNBr, BNPS-skatole) as alternatives for resistant proteins

  • Modified MS/MS Methods:

    • Apply electron-transfer dissociation (ETD) or electron-capture dissociation (ECD) to preserve labile lipid modifications

    • Implement neutral loss scanning for characteristic lipid fragments

    • Use multiple reaction monitoring (MRM) for targeted analysis of known lipopeptides

  • Specialized Data Analysis:

    • Modify search algorithms to account for diacylglyceryl modifications

    • Apply retention time prediction tools optimized for lipopeptides

    • Implement open search strategies to identify unexpected modifications

Lipidomic Integration:

  • Comprehensive Lipid Analysis:

    • Characterize the phospholipid composition of Synechocystis membranes

    • Identify the fatty acid profiles of lipoproteins versus membrane phospholipids

    • Correlate changes in phospholipid composition with alterations in lipoprotein processing

  • Structure Elucidation:

    • Apply ion mobility-mass spectrometry to determine lipopeptide conformations

    • Use NMR spectroscopy for detailed structural characterization of purified lipopeptides

    • Implement molecular dynamics simulations to model lipid-protein interactions

Functional Confirmation Methods:

  • Site-Directed Mutagenesis:

    • Mutate the lipobox consensus sequence to prevent lipidation

    • Create point mutations in catalytic residues of Lgt

    • Generate chimeric proteins to identify minimal lipidation requirements

  • In Vitro Assays:

    • Develop reconstituted systems with purified Lgt and synthetic peptide substrates

    • Use radiolabeled or fluorescently labeled phospholipids to track transfer reactions

    • Implement real-time assays to measure reaction kinetics

  • Visualization Techniques:

    • Apply metabolic labeling with alkyne-fatty acids followed by click chemistry with fluorescent azides

    • Use super-resolution microscopy to visualize lipoprotein localization patterns

    • Implement correlative light and electron microscopy for nanoscale localization

These specialized techniques, when combined with the genetic tools available for Synechocystis , provide a comprehensive framework for analyzing Lgt-dependent lipoprotein modifications and understanding their functional significance in this photosynthetic organism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.