Recombinant Synechocystis sp. Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant SecD

Recombinant Synechocystis sp. SecD corresponds to residues 1–472 of the full-length protein (UniProt: Q55610), encoded by the slr0774 gene. Key features include:

PropertyDetails
Expression SystemEscherichia coli
TagDetermined during production (commonly His-tag for purification)
Sequence LengthPartial (472 amino acids)
StorageTris-based buffer with 50% glycerol; store at -20°C/-80°C
Purity>90% (SDS-PAGE verified)
Functional DomainsIntegral membrane protein with conserved regions for SecYEG interaction

Functional Role in Protein Translocation

SecD operates within the Sec translocase complex (SecYEG-SecDF-YajC) to facilitate post-translational translocation of preproteins. Key mechanisms include:

  • ATPase Coupling: SecD cooperates with SecA ATPase to drive substrate movement through the SecYEG channel via conformational changes .

  • Membrane Integration: Assists in the lateral insertion of transmembrane domains of membrane proteins, working alongside YidC homologs like Slr1471p in Synechocystis .

  • Stress Adaptation: Indirectly supports stress responses by ensuring proper folding/export of membrane-bound photosynthetic components (e.g., D1 protein in PSII repair) .

3.1. Genetic and Phenotypic Studies

  • EPS Secretion: Disruption of ABC transporter kpsM (Slr0977) in Synechocystis reduces extracellular polysaccharide (EPS) secretion and alters glycosylation of PilA1, a major pilin protein. This suggests crosstalk between SecD-dependent translocation and EPS biosynthesis .

  • Protein Secretion Efficiency: Deletion of pilA1 (a Sec substrate) enhances heterologous protein secretion, likely by freeing Sec machinery capacity. Conversely, pilT1 mutants accumulate unprocessed PilA1, impairing SecD-mediated transport .

Applications and Future Directions

  • Biotechnology: Engineered Synechocystis strains with optimized Sec pathways could enhance secretion of biofuels or therapeutic proteins .

  • Antibiotic Targets: SecD’s essential role in bacterial viability makes it a candidate for novel antibiotics targeting Gram-negative pathogens .

  • Photosynthesis Research: Studying SecD’s interaction with thylakoid biogenesis factors (e.g., Slr1471p) may clarify cyanobacterial stress adaptation mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format readily available in our inventory, we are receptive to specific format requests. Kindly include your desired format in your order notes for customized preparation.
Lead Time
Delivery timelines may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are standardly shipped with regular blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise incorporating 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development according to your specifications.
Synonyms
secD; slr0774; Protein translocase subunit SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-472
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
secD
Target Protein Sequence
MQRLRWLLLLIVVLVIGASFVLVKLPLQLGLDLRGGAQLTIEVQPTKEIPQIDNDSLVAV KTVIENRVNALGVSEPLVQTAGEDKIVVQLPGVTDPGQAERILGGTAQLEFQQQRPGTEG EFQAEYSIKRQLDAELENLRRSGASPENSDRLEELIKAKEESNKALLALFEPMGLTGKNL TDARPSPNQSGTAWEVALRFDEEGGQKFAELTQAVAGTGRSLGVFLDNDLISAPVVGVEF ANTGITGGAAVITGNFTIDTANDLAVQLRGGSLPFPVEVVENRTVGATLGQESIRRSLVA GFVGLVLVLVFMAVYYRLPGIVADISLMIYAVLTLAAFALVGVTLTLPGIAGFILSIGMA VDANVLIFERTREELRAGNTLYRSVEAGFFRAFSSILDSNVTTLIACAALFWFGSGLVKG FALTLAIGVMVSLFTALTCSRTLLLVIVLSLPKVRQNPRLFCPNLSSVTAKS
Uniprot No.

Target Background

Function
As a component of the Sec protein translocase complex, SecD interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent function of SecA. It is likely involved in protein translocation across both the cytoplasmic and thylakoid membranes in cyanobacterial cells.
Database Links
Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does SecD from Synechocystis sp. differ structurally and functionally from its E. coli counterpart?

While both proteins serve similar functions in their respective organisms, Synechocystis sp. SecD shows distinct structural features adapted to the unique photosynthetic membrane architecture of cyanobacteria. Functional analyses suggest that unlike E. coli SecD, the Synechocystis variant may have additional roles related to photosynthetic membrane organization. The differences in amino acid sequences between these homologs reflect evolutionary adaptations specific to cyanobacterial protein secretion requirements. When expressed in proteoliposomes, purified SecD proteins from different bacterial sources exhibit varying effects on translocation activity, with Synechocystis SecD showing particular characteristics related to its photosynthetic cellular context .

What are the optimal conditions for overexpression of recombinant Synechocystis sp. SecD protein?

The overexpression of Synechocystis sp. SecD is most efficiently achieved using recombinant DNA technology approaches similar to those used for E. coli SecD. The process typically involves:

  • Gene cloning into an expression vector with an inducible promoter system

  • Transformation into an appropriate host strain (often E. coli)

  • Optimization of expression conditions including:

    • Induction temperature (typically 30°C for membrane proteins)

    • Inducer concentration (e.g., IPTG or rhamnose)

    • Duration of expression (4-16 hours)

    • Media composition (often enriched for membrane protein expression)

For optimal results, expression under the control of a tightly regulated promoter, such as the rhamnose-inducible Prha promoter, allows precise control of expression levels, which is crucial for membrane proteins that may be toxic when overexpressed .

What purification strategy yields the highest purity and functional integrity of SecD protein?

Based on established protocols, the most effective purification strategy for Synechocystis sp. SecD involves sequential techniques:

  • Differential solubilization of membrane fractions to extract SecD

  • Ion-exchange chromatography to separate based on charge properties

  • Size-exclusion chromatography for final purification

This approach has been demonstrated to be effective for SecD purification, maintaining protein integrity and function. The purified protein can then be reconstituted into proteoliposomes for functional assays. It's essential to optimize detergent concentrations during solubilization to prevent protein denaturation while ensuring effective extraction from membrane fractions .

What methods are most effective for assessing the translocation activity of purified SecD protein?

Translocation activity of purified SecD is best assessed through reconstitution experiments using proteoliposomes. The recommended protocol includes:

  • Reconstitution of purified SecD with other Sec components (SecE, SecY) into liposomes

  • Preparation of radiolabeled or fluorescently tagged substrate proteins

  • Incubation of proteoliposomes with substrate proteins under varying conditions

  • Quantification of translocation efficiency through protease protection assays

This approach allows for systematic evaluation of SecD's contribution to translocation activity. According to published results, SecD alone may not significantly enhance translocation, but functions optimally in coordination with other Sec components .

How can researchers accurately quantify the expression levels of SecD in Synechocystis cells?

Accurate quantification of SecD expression requires a combination of approaches:

  • Densitometric analysis of stained SDS-PAGE gels with purified protein standards

  • Immunoblot analysis using SecD-specific antibodies

  • Mass spectrometry-based quantitative proteomics

For relative quantification between wild-type and overexpression strains, immunoblotting provides reliable data. For absolute quantification, a combination of densitometry on stained gels with known standards and immunoblot analysis yields the most accurate results. Using these methods, researchers have estimated approximately 500 Sec translocation machinery complexes per E. coli cell, with similar numbers potentially present in Synechocystis .

What factors should be considered when designing experiments to study SecD interactions with other Sec components?

When designing experiments to study SecD interactions, researchers should consider:

  • Selection of appropriate controls (null mutants, inactive variants)

  • Methods for membrane protein complex isolation that preserve native interactions

  • Detergent selection for solubilization that maintains protein-protein interactions

  • Techniques for detecting transient versus stable interactions

  • Validation through multiple complementary approaches (e.g., co-immunoprecipitation, FRET, cross-linking)

Experimental design should account for the membrane environment's importance in maintaining functional interactions. The validity, reliability, and replicability of results must be ensured through careful selection of independent variables and control variables .

How can secondary data analysis approaches be applied to existing SecD datasets?

Secondary data analysis (SDA) can be a valuable approach for researchers studying SecD by:

  • Identifying existing proteomics or transcriptomics datasets that include SecD

  • Formulating new research questions based on available data

  • Applying advanced statistical techniques to reanalyze data from new perspectives

  • Comparing SecD expression patterns across different growth conditions or mutant strains

What CRISPR-based approaches can be used to modulate SecD expression in Synechocystis sp.?

CRISPR-based modulation of SecD expression can be achieved through:

  • CRISPR interference (CRISPRi) for downregulation:

    • Using dCas12a targeting the secD promoter or coding region

    • Careful selection of guide RNAs based on predicted efficiency

  • CRISPR activation (CRISPRa) for upregulation:

    • Using dCas12a-SoxS fusion construct under rhamnose-inducible promoter

    • Targeting guide RNAs to regions relative to the transcription start site

    • Optimizing the position of guide RNA binding sites (typically -60 to -100 bp upstream of TSS)

The effectiveness of these approaches depends on careful guide RNA design and appropriate induction conditions. Recent developments have established a versatile CRISPRa system for Synechocystis that enables robust multiplexed activation of both heterologous and endogenous targets .

How does SecD function coordinate with extracellular polysaccharide production in Synechocystis sp.?

The relationship between SecD function and extracellular polysaccharide production involves several aspects:

  • Potential role of SecD in the secretion of enzymes involved in sulfated polysaccharide (synechan) biosynthesis

  • Possible coordination between protein secretion and polysaccharide export machinery

  • Cellular localization patterns that may reveal functional relationships

Research suggests that sulfated extracellular polysaccharides in Synechocystis sp. PCC 6803 contribute to bloom-like cell aggregation and biofilm formation. The secretion machinery, including SecD, may play a role in the export of proteins that synthesize or modify these polysaccharides. Further investigation of SecD mutants and their effects on polysaccharide production could provide insights into this potential relationship .

What are common pitfalls in SecD purification and how can they be addressed?

Common pitfalls in SecD purification include:

ChallengeCauseSolution
Low yieldPoor expression or inefficient extractionOptimize induction conditions; adjust detergent concentration
Loss of activityProtein denaturation during purificationUse milder detergents; add stabilizing agents; minimize purification steps
AggregationImproper detergent-to-protein ratioAdjust detergent concentration; use alternative detergents
ContaminationIneffective chromatographyModify salt gradient; add additional purification steps
Partial proteolysisEndogenous protease activityAdd protease inhibitors; reduce purification time

For optimal results, researchers should conduct small-scale pilot purifications to identify potential issues before scaling up. The differential solubilization approach followed by ion-exchange and size-exclusion chromatography has proven effective for SecD purification .

How can researchers address heterogeneity issues in recombinant SecD preparations?

Addressing heterogeneity in recombinant SecD preparations requires systematic approaches:

  • Analyze SDS-PAGE and immunoblots to identify truncated products or degradation

  • Employ mass spectrometry to characterize heterogeneous species

  • Optimize expression conditions to minimize proteolysis or premature termination

  • Consider adding epitope tags at both N- and C-termini to purify only full-length protein

  • Implement more stringent chromatography steps (e.g., adding an affinity purification)

N-terminal sequencing of purified proteins can confirm the presence of the intact protein and identify any truncated forms that may be present. When overproducing membrane proteins like SecD, careful optimization of expression conditions is critical to minimize stress responses that could lead to heterogeneous products .

How does SecD research in Synechocystis sp. contribute to our understanding of cyanobacterial protein secretion systems?

Research on SecD in Synechocystis sp. provides valuable insights into:

  • The unique adaptations of protein secretion systems in photosynthetic organisms

  • Coordination between protein secretion and photosynthetic membrane biogenesis

  • Evolutionary conservation and diversification of bacterial protein translocation machinery

  • Potential biotechnological applications leveraging cyanobacterial secretion systems

By understanding SecD function in Synechocystis, researchers can better elucidate the specialized protein transport mechanisms that support photosynthetic cellular organization. This knowledge may lead to applications in bioengineering for sustainable production of valuable biomolecules .

What approaches can be used to study the global interactome of SecD in Synechocystis's native protein complexes?

To study the global interactome of SecD in Synechocystis, researchers can employ:

  • Co-immunoprecipitation coupled with mass spectrometry (Co-IP-MS)

  • Proximity-dependent biotin labeling (BioID or APEX)

  • Cross-linking mass spectrometry (XL-MS)

  • Native protein complex isolation through blue native PAGE

  • Cryo-electron microscopy of purified complexes

These approaches can reveal both stable and transient interactions of SecD with other cellular components. Recent studies of native protein complexes in Synechocystis sp. PCC 6803 have mapped global protein interaction networks, providing a framework for understanding SecD's integration within the cellular machinery .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.