Recombinant Synechocystis sp. Protein Translocase Subunit SecF (UniProt ID: Q55611) is a full-length, His-tagged protein expressed in Escherichia coli for experimental use . It forms part of the SecYEG translocase complex, which facilitates the post-translational insertion of membrane proteins and secretion of periplasmic proteins across the cytoplasmic membrane . Key specifications include:
| Property | Details |
|---|---|
| Catalog Number | RFL11002SF |
| Amino Acid Range | 1-315aa |
| Tag | N-terminal His tag |
| Expression Host | E. coli |
| Purity | >90% (verified by SDS-PAGE) |
This recombinant variant enables biochemical and structural studies of SecF’s role in the Sec translocase machinery .
SecF operates as a core subunit of the SecYEG-SecDF complex, working with SecA ATPase to drive protein translocation. Key functional insights include:
Membrane Protein Integration: SecF assists in the insertion of integral membrane proteins, including respiratory chain components .
Interactions: Genetic and biochemical studies highlight interactions with Slr1471 (an Oxa1/YidC homolog), which collaborates with SecF to integrate membrane proteins independently of the Sec translocase .
Essentiality: Partial segregation of Slr1471 disrupts membrane biogenesis and D1 protein assembly in Photosystem II, underscoring SecF’s indirect role in photoprotection .
Recombinant SecF has been utilized to dissect SecYEG-SecDF dynamics. For example:
Membrane Integration Studies: SecF-deficient mutants accumulate precursor D1 (pD1) in thylakoid membranes, linking its activity to Photosystem II repair .
Cross-Species Conservation: Functional parallels exist with E. coli YidC, which can complement cyanobacterial mutants, suggesting evolutionary conservation in membrane protein biogenesis .
Structural Dynamics: Resolving SecF’s conformational changes during substrate translocation.
Photoprotection Pathways: Elucidating its role in cyanobacterial stress responses under high-light conditions .
Biotechnological Engineering: Leveraging SecF for synthetic biology applications in membrane protein overexpression .
SecF is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel and utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent function of SecA. SecF likely plays a role in protein translocation across both cytoplasmic and thylakoid membranes in cyanobacteria.
KEGG: syn:slr0775
STRING: 1148.SYNGTS_2155
SecF functions as a translocation factor within the SecDF complex in the general secretory (Sec) system of Synechocystis sp. This complex enhances polypeptide secretion driven by the Sec translocase, which consists of the translocon SecYEG and ATPase SecA . SecDF utilizes the proton gradient across the membrane to effectively pull precursor proteins from the cytoplasm into the periplasm . In Synechocystis, SecDF has been implicated in thylakoid membrane biogenesis and may participate in photosystem II assembly by interacting with different PSII core proteins .
Recombinant SecF from Synechocystis sp. is expressed as a full-length protein (1-315 amino acids) with the following key characteristics:
| Characteristic | Description |
|---|---|
| Length | 315 amino acids |
| Source | Synechococcus sp. |
| Expression system | E. coli |
| Tag | N-terminal His tag |
| Form | Lyophilized powder |
| Amino acid sequence | MKLDLFKWEKPAWIVSSLLVLISIFAMAISWAQFQAPFRPGLDFVGGTRLQLQLECASSN NCPAAIDVAEVQDILGGVGLGNSSVQVIEDYTLSIRQQTLDVEQREAVQKALNEGIGKFD PETIQIDTVGPTVGKALFRSGVLALVISLLGIIIYLTIRFQLDYAVFAIIALLYDALITM GAFAIFGLVGGVEVDSLFLVALLTIIGFSVNDTVVIYDRVRETLERHSDWDINHVVDDAV NQTLTRSINTSLTTSLPLVAIFLFGGDSLKFFALALIIGFASGVYSSIFMATTLWAWWRK WRSPKNPPREMVAEV |
| Purity | >90% as determined by SDS-PAGE |
The protein contains multiple transmembrane domains and a periplasmic region, consistent with its role as an integral membrane protein .
Recombinant Synechocystis sp. SecF is typically expressed in E. coli expression systems . The protein is expressed with an N-terminal His tag to facilitate purification and is expressed as a full-length protein (1-315 amino acids) .
The purification workflow typically involves:
Immobilized metal affinity chromatography (IMAC) using Ni-NTA resins that bind to the His-tag
Further purification using size exclusion chromatography or ion exchange chromatography
Storage in Tris/PBS-based buffer with 6% Trehalose at pH 8.0
For long-term storage, the protein is lyophilized and can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (recommended final concentration) for storage at -20°C/-80°C . Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .
The SecDF complex interacts closely with the translocon SecYEG and positions its periplasmic domain over the precursor exit site of SecYEG . Studies suggest that YidC (another component of the holotranslocon complex) mediates the binding between SecDF and SecYEG .
Atomic force microscopy (AFM) studies have revealed important dynamics in this interaction:
In isolation: SecDF exhibits a stable and compact conformation close to the lipid bilayer surface (resting state)
With SecYEG present: SecDF undergoes significant conformational shifts, with periplasmic protrusions corresponding to an intermediate, active form increasing more than ninefold
Enhanced dynamics: The transition rate between distinct SecDF conformations increases significantly when the translocon is present
This dynamic interaction is essential for efficient protein translocation across bacterial membranes.
SecDF utilizes the proton motive force (PMF) across the membrane to enhance protein translocation through a complex mechanism:
The large periplasmic P1 domain of SecD plays a critical role in stimulating precursor protein transport in a PMF-dependent manner
SecDF harnesses energy from the proton gradient to undergo conformational changes that effectively pull translocating polypeptides from the cytoplasm into the periplasm
This "pulling" action complements the "pushing" force provided by the SecA ATPase, resulting in more efficient protein translocation
When the proton gradient is dissipated, protein translocation efficiency decreases significantly
The exact molecular details of how proton flow through SecDF drives these conformational changes are still being elucidated, but the energy coupling is essential for SecDF function.
AFM studies have revealed significant conformational dynamics in SecDF during protein translocation:
Resting state: In isolation, SecDF exhibits a stable and compact conformation close to the lipid bilayer surface
Active state: Upon interaction with SecYEG, SecDF undergoes notable conformational shifts
Increased dynamics: The population of periplasmic protrusions corresponding to an intermediate form of SecDF increases more than ninefold when SecYEG is present
Enhanced transition rates: The rate of switching between distinct SecDF conformations increases significantly in the presence of the translocon
These PMF-powered conformational changes are essential for SecDF's function in pulling precursor proteins through the membrane. The height distribution of SecYEG·DF protrusions is much broader than that of SecDF alone, exhibiting a substantial population at a height range of ~60 Å, corresponding to the active I-form of the complex .
In Synechocystis sp. PCC 6803, SecDF has been implicated in photosystem II (PSII) assembly through several mechanisms:
SecDF might participate in the PSII assembly process by interacting with different PSII core proteins
Studies with a related protein Slr1471p (an Oxa1p/Alb3/YidC homolog that likely interacts with SecDF) showed that when fused with GFP, the mutant becomes photochemically inhibited at light intensities above 80 μmol photons m⁻²s⁻¹
Analysis revealed that membrane integration of the D1 precursor protein was affected, leading to the accumulation of pD1 in the membrane phase
Direct interaction between Slr1471p and D1 protein was demonstrated, suggesting that SecDF may work in concert with YidC-like proteins to ensure proper PSII assembly
These findings highlight the critical role of SecDF in thylakoid membrane biogenesis and photosynthetic apparatus assembly in cyanobacteria.
CRISPR-based techniques offer powerful approaches for studying SecF function in Synechocystis:
A versatile CRISPRa system has been developed for Synechocystis that enables robust multiplexed activation of both heterologous and endogenous targets . This system uses:
A rhamnose-inducible dCas12-SoxS protein fusion to recruit RNA polymerase at specific promoters
Guide RNAs (gRNAs) designed to target specific genomic locations
Activation efficacy dependent on gRNA position relative to the transcriptional start site (TSS)
For SecF studies, this tool could be used to upregulate secF gene expression and analyze effects on protein translocation and cellular physiology.
A single-step double-recombination approach has been developed that requires only one transformation step :
A vector containing the nptI-sacB double selection cassette is used
Homologous recombination replaces the target genomic sequence with the selection cassette
A second recombination event excises the selection cassette and replaces it with the modified gene sequence
Selection on sucrose-containing media identifies successful recombinants
This approach allows for precise genetic manipulation without leaving antibiotic resistance markers in the genome, facilitating the study of SecF function without confounding effects.
Several biophysical techniques have proven valuable for studying SecDF dynamics:
Atomic Force Microscopy (AFM): Provides direct visualization of SecDF protrusions in near-native supported lipid bilayers with ~100 ms resolution . AFM can capture conformational dynamics and has revealed how SecDF conformations change in the presence of SecYEG .
Electron Microscopy: Offers structural insights at high resolution, particularly when combined with single-particle analysis.
Fluorescence Spectroscopy: Useful for monitoring protein-protein interactions and conformational changes in real-time.
Single-Molecule FRET: Can track conformational changes at the single-molecule level with high temporal resolution.
Proteomics and Structural Biology Approaches: The proteome analysis of Synechocystis sp. PCC 6803 has provided valuable insights into membrane protein complexes including SecDF . Size exclusion chromatography (SEC), ion-exchange chromatography (IEC), and sucrose density gradient centrifugation (Suc-DGC) have been used to fractionate cell lysates and identify protein complexes .
These complementary approaches can together provide a comprehensive understanding of SecDF structure, dynamics, and function.
Environmental conditions significantly impact gene expression and protein function in Synechocystis, including SecF:
Synechocystis can be cultured under several distinct conditions:
Photoautotrophic growth: Using light as the energy source (typically 30-100 μmol photons m⁻²s⁻¹)
Photo-mixotrophic growth: Using both light and glucose (typically BG11 media supplemented with 10 mM glucose at 30°C under 30 μmol photons m⁻²s⁻¹)
Light-activated heterotrophic growth (LAHG): Minimal light exposure (15 min per day at 10 μmol photons m⁻²s⁻¹) with glucose (60 mM) as the carbon source
Studies with related translocation components show that:
Mutant strains can be photochemically inhibited when light intensities increase to 80 μmol photons m⁻²s⁻¹
Light stress can affect the redox potential of photosynthetic components and increase demands on the protein translocation machinery
The function of protein translocation components may be particularly critical under high light conditions when there's increased demand for photosynthetic protein synthesis and membrane biogenesis
These findings suggest that SecF function and importance may vary depending on growth conditions and environmental stresses.
Mutations in SecF can have significant implications for cellular physiology in Synechocystis:
Membrane Protein Integration: Disruptions in related protein translocation components affect the membrane integration of key photosynthetic proteins like the D1 precursor
Photosynthetic Efficiency: Altered protein translocation can lead to photochemical inhibition and changes in the redox potential of reaction center components
Growth and Viability: Related translocation components (like the YidC homolog Slr1471p) are essential for cell viability, suggesting that SecF may also be critical for normal growth
Thylakoid Membrane Biogenesis: SecF likely plays a crucial role in thylakoid membrane formation, with mutations potentially disrupting membrane architecture
Metabolic Changes: Alterations in membrane protein composition can lead to significant changes in cellular metabolism, as observed in studies of other membrane protein mutants
These findings underscore the critical role of SecF in maintaining cellular homeostasis and photosynthetic function in cyanobacteria.