Recombinant Synechocystis sp. Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Synechocystis SecF

Recombinant Synechocystis sp. Protein Translocase Subunit SecF (UniProt ID: Q55611) is a full-length, His-tagged protein expressed in Escherichia coli for experimental use . It forms part of the SecYEG translocase complex, which facilitates the post-translational insertion of membrane proteins and secretion of periplasmic proteins across the cytoplasmic membrane . Key specifications include:

PropertyDetails
Catalog NumberRFL11002SF
Amino Acid Range1-315aa
TagN-terminal His tag
Expression HostE. coli
Purity>90% (verified by SDS-PAGE)

This recombinant variant enables biochemical and structural studies of SecF’s role in the Sec translocase machinery .

Functional Role in the Sec Translocase System

SecF operates as a core subunit of the SecYEG-SecDF complex, working with SecA ATPase to drive protein translocation. Key functional insights include:

  • Membrane Protein Integration: SecF assists in the insertion of integral membrane proteins, including respiratory chain components .

  • Interactions: Genetic and biochemical studies highlight interactions with Slr1471 (an Oxa1/YidC homolog), which collaborates with SecF to integrate membrane proteins independently of the Sec translocase .

  • Essentiality: Partial segregation of Slr1471 disrupts membrane biogenesis and D1 protein assembly in Photosystem II, underscoring SecF’s indirect role in photoprotection .

3.1. Protein Translocation Mechanisms

Recombinant SecF has been utilized to dissect SecYEG-SecDF dynamics. For example:

  • Membrane Integration Studies: SecF-deficient mutants accumulate precursor D1 (pD1) in thylakoid membranes, linking its activity to Photosystem II repair .

  • Cross-Species Conservation: Functional parallels exist with E. coli YidC, which can complement cyanobacterial mutants, suggesting evolutionary conservation in membrane protein biogenesis .

Comparative Insights from Related Systems

OrganismSecF HomologKey Functional Differences
Synechocystis sp.SecF (Q55611)Essential for thylakoid membrane biogenesis .
E. coliSecF (P0AGA2)Partners with SecD; critical for periplasmic protein export .
ArabidopsisAlb3Evolved independently; integrates chloroplast membrane proteins .

Future Research Directions

  • Structural Dynamics: Resolving SecF’s conformational changes during substrate translocation.

  • Photoprotection Pathways: Elucidating its role in cyanobacterial stress responses under high-light conditions .

  • Biotechnological Engineering: Leveraging SecF for synthetic biology applications in membrane protein overexpression .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per customer needs.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If a specific tag is required, please inform us; we will prioritize development accordingly.
Synonyms
secF; slr0775; Protein translocase subunit SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
secF
Target Protein Sequence
MKLDLFKWEKPAWIVSSLLVLISIFAMAISWAQFQAPFRPGLDFVGGTRLQLQLECASSN NCPAAIDVAEVQDILGGVGLGNSSVQVIEDYTLSIRQQTLDVEQREAVQKALNEGIGKFD PETIQIDTVGPTVGKALFRSGVLALVISLLGIIIYLTIRFQLDYAVFAIIALLYDALITM GAFAIFGLVGGVEVDSLFLVALLTIIGFSVNDTVVIYDRVRETLERHSDWDINHVVDDAV NQTLTRSINTSLTTSLPLVAIFLFGGDSLKFFALALIIGFASGVYSSIFMATTLWAWWRK WRSPKNPPREMVAEV
Uniprot No.

Target Background

Function

SecF is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel and utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent function of SecA. SecF likely plays a role in protein translocation across both cytoplasmic and thylakoid membranes in cyanobacteria.

Database Links
Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of SecF in Synechocystis sp.?

SecF functions as a translocation factor within the SecDF complex in the general secretory (Sec) system of Synechocystis sp. This complex enhances polypeptide secretion driven by the Sec translocase, which consists of the translocon SecYEG and ATPase SecA . SecDF utilizes the proton gradient across the membrane to effectively pull precursor proteins from the cytoplasm into the periplasm . In Synechocystis, SecDF has been implicated in thylakoid membrane biogenesis and may participate in photosystem II assembly by interacting with different PSII core proteins .

What are the structural characteristics of recombinant SecF protein?

Recombinant SecF from Synechocystis sp. is expressed as a full-length protein (1-315 amino acids) with the following key characteristics:

CharacteristicDescription
Length315 amino acids
SourceSynechococcus sp.
Expression systemE. coli
TagN-terminal His tag
FormLyophilized powder
Amino acid sequenceMKLDLFKWEKPAWIVSSLLVLISIFAMAISWAQFQAPFRPGLDFVGGTRLQLQLECASSN NCPAAIDVAEVQDILGGVGLGNSSVQVIEDYTLSIRQQTLDVEQREAVQKALNEGIGKFD PETIQIDTVGPTVGKALFRSGVLALVISLLGIIIYLTIRFQLDYAVFAIIALLYDALITM GAFAIFGLVGGVEVDSLFLVALLTIIGFSVNDTVVIYDRVRETLERHSDWDINHVVDDAV NQTLTRSINTSLTTSLPLVAIFLFGGDSLKFFALALIIGFASGVYSSIFMATTLWAWWRK WRSPKNPPREMVAEV
Purity>90% as determined by SDS-PAGE

The protein contains multiple transmembrane domains and a periplasmic region, consistent with its role as an integral membrane protein .

Expression Systems:

Recombinant Synechocystis sp. SecF is typically expressed in E. coli expression systems . The protein is expressed with an N-terminal His tag to facilitate purification and is expressed as a full-length protein (1-315 amino acids) .

Purification Methods:

The purification workflow typically involves:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resins that bind to the His-tag

  • Further purification using size exclusion chromatography or ion exchange chromatography

  • Storage in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

For long-term storage, the protein is lyophilized and can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (recommended final concentration) for storage at -20°C/-80°C . Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

How does the SecDF complex interact with other components of the Sec translocase?

The SecDF complex interacts closely with the translocon SecYEG and positions its periplasmic domain over the precursor exit site of SecYEG . Studies suggest that YidC (another component of the holotranslocon complex) mediates the binding between SecDF and SecYEG .

Atomic force microscopy (AFM) studies have revealed important dynamics in this interaction:

  • In isolation: SecDF exhibits a stable and compact conformation close to the lipid bilayer surface (resting state)

  • With SecYEG present: SecDF undergoes significant conformational shifts, with periplasmic protrusions corresponding to an intermediate, active form increasing more than ninefold

  • Enhanced dynamics: The transition rate between distinct SecDF conformations increases significantly when the translocon is present

This dynamic interaction is essential for efficient protein translocation across bacterial membranes.

How does the proton motive force mechanism of SecDF contribute to protein translocation?

SecDF utilizes the proton motive force (PMF) across the membrane to enhance protein translocation through a complex mechanism:

  • The large periplasmic P1 domain of SecD plays a critical role in stimulating precursor protein transport in a PMF-dependent manner

  • SecDF harnesses energy from the proton gradient to undergo conformational changes that effectively pull translocating polypeptides from the cytoplasm into the periplasm

  • This "pulling" action complements the "pushing" force provided by the SecA ATPase, resulting in more efficient protein translocation

  • When the proton gradient is dissipated, protein translocation efficiency decreases significantly

The exact molecular details of how proton flow through SecDF drives these conformational changes are still being elucidated, but the energy coupling is essential for SecDF function.

What conformational changes occur in SecDF during protein translocation?

AFM studies have revealed significant conformational dynamics in SecDF during protein translocation:

  • Resting state: In isolation, SecDF exhibits a stable and compact conformation close to the lipid bilayer surface

  • Active state: Upon interaction with SecYEG, SecDF undergoes notable conformational shifts

  • Increased dynamics: The population of periplasmic protrusions corresponding to an intermediate form of SecDF increases more than ninefold when SecYEG is present

  • Enhanced transition rates: The rate of switching between distinct SecDF conformations increases significantly in the presence of the translocon

These PMF-powered conformational changes are essential for SecDF's function in pulling precursor proteins through the membrane. The height distribution of SecYEG·DF protrusions is much broader than that of SecDF alone, exhibiting a substantial population at a height range of ~60 Å, corresponding to the active I-form of the complex .

What roles does SecDF play in photosystem II assembly in cyanobacteria?

In Synechocystis sp. PCC 6803, SecDF has been implicated in photosystem II (PSII) assembly through several mechanisms:

  • SecDF might participate in the PSII assembly process by interacting with different PSII core proteins

  • Studies with a related protein Slr1471p (an Oxa1p/Alb3/YidC homolog that likely interacts with SecDF) showed that when fused with GFP, the mutant becomes photochemically inhibited at light intensities above 80 μmol photons m⁻²s⁻¹

  • Analysis revealed that membrane integration of the D1 precursor protein was affected, leading to the accumulation of pD1 in the membrane phase

  • Direct interaction between Slr1471p and D1 protein was demonstrated, suggesting that SecDF may work in concert with YidC-like proteins to ensure proper PSII assembly

These findings highlight the critical role of SecDF in thylakoid membrane biogenesis and photosynthetic apparatus assembly in cyanobacteria.

How can CRISPR-based techniques be used to study SecF function in Synechocystis?

CRISPR-based techniques offer powerful approaches for studying SecF function in Synechocystis:

CRISPR Activation (CRISPRa) System:

A versatile CRISPRa system has been developed for Synechocystis that enables robust multiplexed activation of both heterologous and endogenous targets . This system uses:

  • A rhamnose-inducible dCas12-SoxS protein fusion to recruit RNA polymerase at specific promoters

  • Guide RNAs (gRNAs) designed to target specific genomic locations

  • Activation efficacy dependent on gRNA position relative to the transcriptional start site (TSS)

For SecF studies, this tool could be used to upregulate secF gene expression and analyze effects on protein translocation and cellular physiology.

Marker-less Gene Replacement:

A single-step double-recombination approach has been developed that requires only one transformation step :

  • A vector containing the nptI-sacB double selection cassette is used

  • Homologous recombination replaces the target genomic sequence with the selection cassette

  • A second recombination event excises the selection cassette and replaces it with the modified gene sequence

  • Selection on sucrose-containing media identifies successful recombinants

This approach allows for precise genetic manipulation without leaving antibiotic resistance markers in the genome, facilitating the study of SecF function without confounding effects.

What biophysical techniques are most informative for studying SecDF dynamics?

Several biophysical techniques have proven valuable for studying SecDF dynamics:

  • Atomic Force Microscopy (AFM): Provides direct visualization of SecDF protrusions in near-native supported lipid bilayers with ~100 ms resolution . AFM can capture conformational dynamics and has revealed how SecDF conformations change in the presence of SecYEG .

  • Electron Microscopy: Offers structural insights at high resolution, particularly when combined with single-particle analysis.

  • Fluorescence Spectroscopy: Useful for monitoring protein-protein interactions and conformational changes in real-time.

  • Single-Molecule FRET: Can track conformational changes at the single-molecule level with high temporal resolution.

  • Proteomics and Structural Biology Approaches: The proteome analysis of Synechocystis sp. PCC 6803 has provided valuable insights into membrane protein complexes including SecDF . Size exclusion chromatography (SEC), ion-exchange chromatography (IEC), and sucrose density gradient centrifugation (Suc-DGC) have been used to fractionate cell lysates and identify protein complexes .

These complementary approaches can together provide a comprehensive understanding of SecDF structure, dynamics, and function.

How do environmental conditions affect SecF expression and function in Synechocystis?

Environmental conditions significantly impact gene expression and protein function in Synechocystis, including SecF:

Growth Conditions:

Synechocystis can be cultured under several distinct conditions:

  • Photoautotrophic growth: Using light as the energy source (typically 30-100 μmol photons m⁻²s⁻¹)

  • Photo-mixotrophic growth: Using both light and glucose (typically BG11 media supplemented with 10 mM glucose at 30°C under 30 μmol photons m⁻²s⁻¹)

  • Light-activated heterotrophic growth (LAHG): Minimal light exposure (15 min per day at 10 μmol photons m⁻²s⁻¹) with glucose (60 mM) as the carbon source

Impact on Protein Translocation:

Studies with related translocation components show that:

  • Mutant strains can be photochemically inhibited when light intensities increase to 80 μmol photons m⁻²s⁻¹

  • Light stress can affect the redox potential of photosynthetic components and increase demands on the protein translocation machinery

  • The function of protein translocation components may be particularly critical under high light conditions when there's increased demand for photosynthetic protein synthesis and membrane biogenesis

These findings suggest that SecF function and importance may vary depending on growth conditions and environmental stresses.

What are the implications of SecF mutations on cellular physiology in Synechocystis?

Mutations in SecF can have significant implications for cellular physiology in Synechocystis:

  • Membrane Protein Integration: Disruptions in related protein translocation components affect the membrane integration of key photosynthetic proteins like the D1 precursor

  • Photosynthetic Efficiency: Altered protein translocation can lead to photochemical inhibition and changes in the redox potential of reaction center components

  • Growth and Viability: Related translocation components (like the YidC homolog Slr1471p) are essential for cell viability, suggesting that SecF may also be critical for normal growth

  • Thylakoid Membrane Biogenesis: SecF likely plays a crucial role in thylakoid membrane formation, with mutations potentially disrupting membrane architecture

  • Metabolic Changes: Alterations in membrane protein composition can lead to significant changes in cellular metabolism, as observed in studies of other membrane protein mutants

These findings underscore the critical role of SecF in maintaining cellular homeostasis and photosynthetic function in cyanobacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.