Recombinant Synechocystis sp. Proton extrusion protein PcxA (pcxA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
pcxA; cotA; slr1596; Proton extrusion protein PcxA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-440
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
pcxA
Target Protein Sequence
MDLTNWWQGATQWFGRSSQKSLEQAFRSALKIKEIEDQYFQGKKIGPENCDYSADTVTYF ANQIQRHLRKIEQEIYHLNSDQEFVKILSLDPAVKQDPQTEYVLNQLQFIDDILQRYDGE LPQVSPPKQIANGGVLDLPAITANKQRQINKKRRDGFQYIRREDTQQKVDTATQKSGVLP RSFLRTIDRLKREMDPQSSDTEQKVLKQYRNSRYKTALSIKFVLTLIIVPLLAHQLTKTF FLLPSVESFFERNSEVVFINQSMETEAYEELSHFEESLRFRELLGFGEKLSPEAKEEKLA EKAKEISESYRRVSTNAIANIFADIFSLVAFSLVLVNSQREIEVLKEFIDEIVYGLSDSA KAFLIILFTDMFVGFHSPHGWEVILASIARHFGLPENQDFNFLFIATFPVILDTVFKYWI FRYLNSISPSAVATYRNMNE
Uniprot No.

Target Background

Function

Recombinant Synechocystis sp. Proton extrusion protein PcxA (pcxA) is involved in light-induced Na+-dependent proton extrusion and may also participate in CO2 transport.

Database Links
Protein Families
Cema family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Synechocystis sp. PCC 6803 and why is it significant for proton extrusion studies?

Synechocystis sp. PCC 6803 is a unicellular cyanobacterium widely used as a model organism in photosynthesis research due to its fully sequenced genome and natural transformability. This organism possesses several genes involved in photorespiration and proton extrusion mechanisms that are critical for maintaining cellular pH homeostasis and energy balance, particularly under varying light and carbon dioxide conditions .

The significance of Synechocystis for proton extrusion studies lies in its relatively simple cellular structure compared to higher plants, while still maintaining core photosynthetic machinery. Researchers have identified several proteins involved in proton movement across membranes, with proteins like CotA being well-characterized components of light-induced proton extrusion systems .

How are proton extrusion proteins traditionally identified and characterized in Synechocystis?

Proton extrusion proteins in Synechocystis are typically identified through a combination of genomic analysis, targeted gene disruption, and functional complementation studies. The standard methodology involves:

  • Genome analysis: Identifying candidate genes through homology searches and conserved domain analysis

  • Gene disruption: Creating knockout mutants through insertion of antibiotic resistance cassettes

  • Phenotypic assessment: Measuring changes in proton extrusion activity

  • Complementation studies: Reintroducing functional genes to confirm phenotype restoration

For example, the CotA protein involved in light-induced proton extrusion was characterized by creating cotA-less mutants (M29) and then complementing with either long (L-cotA) or short (S-cotA) versions of the gene to determine the functional form. The L-cotA (440 amino acids) restored wild-type proton extrusion activity, while S-cotA (247 amino acids) failed to do so, confirming that the full-length protein is required for activity .

What experimental methods are essential for measuring proton extrusion activity?

Measuring proton extrusion activity in Synechocystis requires specialized techniques to detect often subtle pH changes in the medium. Standard methodologies include:

TechniqueApplicationAdvantagesLimitations
pH electrode measurementsReal-time monitoring of medium pHDirect measurement, quantitativeLimited sensitivity
pH-sensitive fluorescent dyesSubcellular pH monitoringHigh sensitivity, spatial resolutionPotential interference with cellular processes
Genetic reportersIn vivo activity monitoringNon-invasive, continuous monitoringIndirect measurement
Isotope labelingTracking proton exchange ratesHighly quantitativeTechnical complexity, equipment requirements

For accurate results, researchers typically normalize measurements to cell density and control for non-specific effects by comparing wild-type strains to specific gene knockout mutants under identical conditions. Experimental design should include appropriate controls for light intensity, temperature, and medium composition, as these factors significantly influence proton extrusion rates .

What are the key considerations for expressing recombinant proton extrusion proteins from Synechocystis?

Expressing recombinant proton extrusion proteins from Synechocystis requires careful consideration of several factors to ensure functional protein production:

  • Expression system selection: E. coli is commonly used due to ease of cultivation and high protein yields, though membrane proteins often require specialized strains

  • Gene optimization: Codon optimization for the host organism may be necessary

  • Fusion tags: Addition of purification tags (His, GST) must be designed to minimize impact on protein function

  • Membrane protein considerations: Inclusion of appropriate signal sequences and membrane-spanning domains

When expressing proton extrusion proteins, researchers have successfully used approaches such as fusing partial gene products to glutathione S-transferase (GST) in E. coli, as demonstrated with CotA protein. This approach facilitated the production of antibodies against both N- and C-terminal regions, which were subsequently used to determine the protein's membrane localization and size (52 kDa) .

How can researchers determine the subcellular localization of proton extrusion proteins in Synechocystis?

Determining the subcellular localization of proton extrusion proteins in Synechocystis involves several complementary approaches:

  • Membrane fractionation: Separation of cytoplasmic and thylakoid membranes through differential centrifugation

  • Western blotting: Using specific antibodies to detect the protein of interest in isolated membrane fractions

  • Immunogold electron microscopy: Providing high-resolution localization data

  • Fluorescent protein fusions: Visualizing protein localization in living cells

Research on CotA protein demonstrated the importance of using multiple approaches to confirm localization. While CotA was detected in both cytoplasmic and thylakoid membrane fractions using western blotting, the signal was stronger in the cytoplasmic membrane fraction. Importantly, cross-reactivity controls with known membrane-specific proteins (e.g., NrtA) revealed potential cross-contamination between membrane fractions, highlighting the need for rigorous controls when making localization claims .

What approaches are effective for studying structure-function relationships in proton extrusion proteins?

Structure-function relationships in proton extrusion proteins can be elucidated through:

  • Site-directed mutagenesis: Targeting conserved amino acids to assess their contribution to function

  • Truncation analysis: Creating shortened versions of the protein to identify essential domains

  • Chimeric proteins: Swapping domains between related proteins to determine functional regions

  • Computational modeling: Predicting structure based on homology and assessing conservation

The approach taken with CotA illustrates this methodology, where researchers tested both long (L-cotA, 440 amino acids) and short (S-cotA, 247 amino acids) versions of the protein. By inserting these constructs into a cotA-less mutant and measuring proton extrusion activity, they definitively showed that the full-length protein was required for function, highlighting the importance of N-terminal regions that would have been absent in the shorter construct .

How can researchers address contradictory data in proton extrusion protein studies?

Contradictory data is common in biological research and requires systematic approaches to resolve:

  • Standardize experimental conditions: Ensure consistent growth conditions, light intensity, and carbon dioxide levels

  • Control for genetic background effects: Use isogenic strains and multiple independent transformants

  • Employ orthogonal measurement techniques: Validate findings using independent methodologies

  • Conduct statistical analyses: Apply appropriate statistical tests to determine significance

What experimental design principles should be applied when studying environmental effects on proton extrusion activity?

When studying environmental effects on proton extrusion activity, a structured experimental design approach should include:

  • Factorial design: Systematically varying multiple factors (light, temperature, pH, CO₂)

  • Appropriate controls: Including both positive and negative controls for each condition

  • Time-course measurements: Capturing both immediate and adaptive responses

  • Biological replicates: Using independent cultures to account for biological variation

A well-designed experiment might resemble the approach used in material coating studies, with the following structure:

FactorLevels
Light intensityLow, Medium, High
Carbon dioxideAmbient (LC), Elevated (HC)
Growth phaseEarly log, Mid log, Stationary

Data should be collected at multiple time points (T₀, T₁, T₂, etc.) to capture dynamic responses, similar to the temporal measurements used in degradation studies . This approach allows for comprehensive analysis of how environmental factors influence proton extrusion activity.

How can advanced genetic approaches be applied to study regulatory networks controlling proton extrusion proteins?

Advanced genetic approaches for studying regulatory networks include:

  • CRISPR/Cas9 genome editing: Creating precise mutations without antibiotic markers

  • RNAseq transcriptomics: Identifying co-regulated genes under various conditions

  • ChIP-seq: Mapping transcription factor binding sites

  • Ribosome profiling: Determining translational regulation

These approaches can reveal how proton extrusion proteins are integrated into broader cellular responses. For example, researchers studying photorespiratory mechanisms in Synechocystis have demonstrated that multiple genes may have redundant functions, with phenotypes only becoming apparent when multiple genes are disrupted . This principle likely applies to proton extrusion mechanisms as well, suggesting that comprehensive analysis of regulatory networks requires targeting multiple components simultaneously.

What methodologies are most effective for integrating proton extrusion protein studies with global metabolic analysis?

Integrating proton extrusion studies with global metabolic analysis requires:

  • Metabolomics: Quantifying changes in metabolite levels in response to altered proton extrusion

  • Isotope labeling: Tracking metabolic flux through central carbon metabolism

  • Proteomics: Identifying changes in protein abundance and post-translational modifications

  • Systems biology modeling: Integrating multiple data types into predictive models

Research on photorespiratory enzymes in Synechocystis demonstrates how metabolite profiling can reveal unexpected connections between seemingly distinct processes. When photorespiratory phosphoglycolate phosphatases (PGPases) were inactivated, researchers observed not only changes in 2-phosphoglycolate levels but also alterations in other phosphorylated intermediates such as glucose 6-phosphate and 3-phosphoglycerate . This highlights how proton homeostasis may be interconnected with primary carbon metabolism, requiring integrated analytical approaches.

What are the critical controls needed when generating antibodies against membrane-associated proton extrusion proteins?

Generating reliable antibodies against membrane proteins requires several critical controls:

  • Antigen design: Using hydrophilic regions or partial proteins to improve immunogenicity

  • Cross-reactivity testing: Validating against knockout mutants to confirm specificity

  • Epitope mapping: Determining which regions of the protein are recognized

  • Validation in multiple applications: Testing in Western blot, immunoprecipitation, and immunolocalization

The approach used for CotA protein exemplifies this methodology, where researchers generated two kinds of antibodies against different regions (N- and C-terminal) of the protein fused to GST. Both antibodies detected the same 52 kDa band in membrane fractions, and critically, this band was absent in the cotA knockout mutant (M29), confirming antibody specificity .

How can researchers optimize heterologous expression of cyanobacterial membrane proteins?

Optimizing heterologous expression of cyanobacterial membrane proteins involves:

  • Expression host selection: Specialized E. coli strains (C41, C43) designed for membrane proteins

  • Induction conditions: Lower temperatures (16-25°C) and reduced inducer concentrations

  • Membrane-mimicking environments: Detergents, nanodiscs, or liposomes for proper folding

  • Fusion partners: MBP, Mistic, or SUMO tags to improve solubility and folding

Expression studies of cyanobacterial proteins in E. coli have demonstrated that optimization can significantly improve protein yields. For instance, when expressing PGPases from Synechocystis in E. coli, researchers observed up to 2 times higher enzymatic activity in cell extracts compared to controls, indicating successful expression of functional protein .

How might high-throughput approaches advance our understanding of proton extrusion mechanisms?

High-throughput approaches offer several advantages for advancing proton extrusion research:

  • CRISPR screens: Systematic gene disruption to identify new components

  • Synthetic biology: Building minimal systems to test hypotheses about required components

  • Microfluidics: Real-time monitoring of individual cell responses

  • Automated phenotyping: Measuring growth and physiological parameters under hundreds of conditions

These approaches could help identify previously unknown components of proton extrusion systems and reveal how these systems are integrated with other cellular processes, potentially leading to new insights into cyanobacterial physiology and applications in biotechnology.

What are the emerging technologies for studying proton dynamics in live cyanobacterial cells?

Emerging technologies for studying proton dynamics include:

  • Genetically encoded pH sensors: Proteins like pHluorin that can be targeted to specific subcellular compartments

  • Super-resolution microscopy: Techniques like STORM or PALM for nanoscale visualization

  • Microelectrode arrays: For spatial mapping of proton fluxes around cells

  • Light-controlled proton pumps: Optogenetic tools to manipulate cellular pH

These technologies promise to provide unprecedented spatial and temporal resolution of proton movements, potentially revealing how proton gradients contribute to energy homeostasis in cyanobacteria under changing environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.