Recombinant Synechocystis sp. Putative biopolymer transport protein exbB-like 1 (sll0477) is a protein that is produced using recombinant DNA technology in Synechocystis sp. (strain PCC 6803 / Kazusa) . Sll0477 is a gene name for this protein, which is also known as Putative biopolymer transport protein exbB-like 1 . Synechocystis sp. PCC 6803 is a model organism for studying photosynthesis, energy metabolism, and environmental stress .
mLDNCKRLLFRKFPCFLSMAPSPLFLTQTPRLLDEFLKGGVVMFPLLLLSILALTTAFER
GWFWSRLLIQEDQVVRDVLDAAVEDLVKAREIAEHARHLAIGRFLLAPLKLRHPSPETFR
LAMEATADKEFARMRRGDKLLETIIALAPLLGLLGTVTGLIRTFNNLNIGGGGSSAEATQ
AASGIGEALITTAAGMMVAIFALLVFRVLVSLQSQQMDYFAAVGSELELIYREVWYEPHQ
PMPNLLMAARIAEP
Sll0477 is similar to ExbB, a component of the TonB complex that is involved in the transport of biopolymers across the outer membrane in bacteria . Studies suggest that Sll0477 may play a role in the transport of exopolysaccharides (EPS) . EPS are important for cell sedimentation and protection against salt and metal stresses .
During prolonged ethanol production in Synechocystis sp., the expression of sll0477 is altered . Specifically, transcriptomic analysis revealed the following changes in the expression of sll0477 under ethanol production:
| Day 4 | Day 7 | Day 11 | Day 18 | |
|---|---|---|---|---|
| sll0477-as2 | -0.43 | -0.86 | 0.67 | -2.77 |
These values represent the log2 fold change in transcript levels .
Sll0477 is involved in protein-protein interactions (PPIs) within Synechocystis sp . It forms a stable association with pilus assembly proteins, Slr2015 and Slr2018, as well as with photosystem complexes .
KEGG: syn:sll0477
STRING: 1148.SYNGTS_2628
Recombinant Synechocystis sp. Putative biopolymer transport protein exbB-like 1 (sll0477) is a full-length protein (254 amino acids) that functions as part of membrane transport systems in cyanobacteria. The protein is classified as a biopolymer transport protein based on sequence homology with other ExbB proteins that typically form complexes with ExbD to create energizing systems for various transport processes. In recombinant form, the protein is commonly expressed in E. coli with an N-terminal His-tag to facilitate purification and subsequent functional studies . The protein is encoded by the sll0477 gene in Synechocystis sp. and has the UniProt ID Q55834, which can be used to access comprehensive sequence information and predicted functional domains .
Recent structural studies of ExbB proteins, which are homologous to sll0477, have revealed that these proteins typically form hexameric complexes. X-ray crystallography and single-particle cryo-EM analyses have demonstrated that ExbB proteins organize into hexameric assemblies that interact with ExbD to create functional transport units .
The structural organization of exbB-like 1 (sll0477) includes:
Multiple transmembrane domains that anchor the protein within the cytoplasmic membrane
Cytoplasmic domains involved in energy transduction
Potential interaction surfaces for complex formation with partner proteins
Crystal structures of related ExbB proteins have been obtained under specific conditions (0.1 M glycine, pH 9.0, 0.15 M CaCl₂, ~40% PEG 350 MME, and 0.05–0.2 M L-arginine), resulting in plate-like crystals of approximately 100 μm × 100 μm × 10 μm that grow over 1–2 months . Hexagonal crystals were specifically observed in mother liquors at pH 5.4, suggesting pH-dependent structural arrangements that may have functional significance .
The methodological approach for expression and purification of recombinant exbB-like 1 (sll0477) typically follows this protocol:
Expression System: The protein is commonly expressed in E. coli using appropriate expression vectors containing the sll0477 gene fused to an N-terminal His-tag .
Purification Process:
Initial purification via metal affinity chromatography using the His-tag
For higher purity, researchers can implement a TEV protease cleavage site between the protein and His-tag
After His-tag binding, cleavage with TEV protease (3-hour incubation at room temperature)
Removal of imidazole by passing through a desalting column
Rebinding to metal affinity resin (1 hour at 4°C) to separate cleaved protein
Buffer Conditions: The protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .
Storage Recommendations: For optimal stability, the protein should be stored at -20°C/-80°C with the addition of 5-50% glycerol (50% being common practice). Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .
ExbB proteins, including exbB-like 1 (sll0477), typically form complexes with ExbD proteins to create functional transport units. Recent structural studies have demonstrated that ExbB proteins organize into hexameric complexes that interact with ExbD . This interaction is critical for energy transduction during transport processes.
The complex formation process involves:
Assembly of ExbB monomers into a hexameric structure within the membrane
Association with ExbD components to form a complete ExbBD complex
Potential interactions with additional transport components specific to the substrates being transported
To study these interactions experimentally, researchers can:
Use pull-down assays with the His-tagged recombinant protein to identify interaction partners
Implement crosslinking approaches to capture transient interactions
Apply native mass spectrometry to determine complex stoichiometry
Utilize two-hybrid systems to validate specific protein-protein interactions in vivo
The functional significance of these complexes likely relates to creating energy-coupling mechanisms for transport processes, similar to TonB-dependent transport systems in other bacteria .
Based on successful crystallization of related ExbB complexes, the following methodological approach is recommended:
Protein Preparation:
Concentrate the purified protein complex to approximately 10 mg/ml
Ensure high homogeneity through rigorous SEC purification
Verify complex stability through dynamic light scattering prior to crystallization attempts
Crystallization Conditions:
Implement extensive screening over sparse matrix conditions using automated systems (e.g., Mosquito crystallization robot)
Effective conditions include 0.1 M glycine, pH 9.0, 0.15 M CaCl₂, ~40% PEG 350 MME, and 0.05–0.2 M L-arginine
Use hanging-drop vapor diffusion at 20°C
Note that different crystal forms may be obtained at varying pH values (hexagonal crystals form at pH 5.4)
Crystal Growth Timeline:
Data Collection:
CRISPR activation (CRISPRa) systems offer powerful tools for studying exbB-like 1 (sll0477) function through targeted upregulation of gene expression. Recent developments in CRISPRa for Synechocystis provide methodological approaches applicable to studying sll0477:
CRISPRa System Design:
Target Site Selection:
Transformation Protocol:
Prepare cargo E. coli strain with target plasmid and helper strain HB101 containing the pRL443-Amp^R plasmid
Grow overnight at 37°C in LB with appropriate antibiotics (50 μg/mL kanamycin for cargo strain; 100 μg/mL ampicillin for helper strain)
Centrifuge 1 mL of each E. coli strain and recipient Synechocystis (OD₇₅₀ ≈ 1.0) at 3,000 × g for 5 minutes
Resuspend in fresh media and combine cargo and helper strains
Wash twice in LB while washing Synechocystis cells twice in BG11
Combine 50 μL Synechocystis with the E. coli mixture and incubate at 30°C, 120 rpm, 50 μmol photons m⁻² s⁻¹ for 1.5-2 hours
Plate on nitrocellulose membranes on non-selective BG11 plates
Transfer membranes to selective plates after 20-24 hours and incubate until colonies form (5-7 days)
Functional Analysis:
Use RT-qPCR to confirm upregulation of sll0477
Assess phenotypic consequences of overexpression
Perform complementary studies with CRISPRi (interference) to compare loss and gain of function
Understanding the membrane topology of exbB-like 1 (sll0477) is critical for determining its functional mechanisms. The following methodological approaches are recommended:
Computational Prediction:
Apply multiple topology prediction algorithms (TMHMM, HMMTOP, Phobius)
Create a consensus model from multiple predictions
Identify potential transmembrane domains, cytoplasmic regions, and periplasmic loops
Experimental Verification:
Cysteine scanning mutagenesis: Introduce cysteine residues at various positions and assess accessibility to membrane-impermeant thiol-reactive reagents
PhoA/LacZ fusion analysis: Create fusion proteins with reporters that have activity dependent on cellular localization
Protease protection assays: Determine which regions are protected from proteolytic digestion in membrane preparations
Fluorescence resonance energy transfer (FRET): Assess proximity relationships between domains
Structural Studies:
Implement cryo-EM analysis of reconstituted complexes in nanodiscs or detergent micelles
Use hydrogen-deuterium exchange mass spectrometry to identify solvent-exposed regions
Apply crosslinking approaches to determine proximity relationships between domains
Data Integration:
Combine computational predictions with experimental results to create a comprehensive topology model
Compare with known structures of homologous proteins to identify conserved features
Correlate topology information with functional data to develop mechanistic models
Maintaining stability of membrane proteins like exbB-like 1 (sll0477) requires careful optimization of buffer conditions. Based on available data, the following methodological approach is recommended:
Additional considerations:
Storage Recommendations:
Reconstitution Guidelines:
Stability Monitoring:
Use dynamic light scattering to assess aggregation state
Apply differential scanning fluorimetry to determine thermal stability under varying conditions
Conduct activity assays to verify functional integrity after storage
Verifying successful incorporation of exbB-like 1 (sll0477) into membrane models is crucial for functional studies. The following methodological approach is recommended:
Robust functional assays for exbB-like 1 (sll0477) require appropriate controls to ensure validity and reproducibility. The following methodological controls are recommended:
| Control Type | Purpose | Implementation |
|---|---|---|
| Negative Control | Establish baseline/background | Empty liposomes or membranes without exbB-like 1 |
| Positive Control | Validate assay functionality | Well-characterized related transport protein |
| Inactive Mutant | Confirm specificity | Site-directed mutants affecting key functional residues |
| Competitive Inhibition | Verify transport specificity | Addition of excess substrate to block specific transport |
| Temperature Controls | Distinguish active vs. passive processes | Perform assays at 4°C vs. 30°C |
| Energy Coupling Controls | Confirm energy requirement | +/- ATP, proton gradient, or other energy sources |
| Buffer Controls | Rule out buffer artifacts | Vary buffer components systematically |
| Detergent Controls | Account for detergent effects | Test various detergent concentrations |
| Directionality Controls | Verify transport direction | Inside-out vs. right-side-out membrane preparations |
| Time Course Controls | Establish kinetics | Multiple time points to establish transport rates |
Additionally, when studying exbB-like 1 complexes with partner proteins:
Use individually expressed proteins as controls
Create interaction-deficient mutants to confirm specificity
Include stoichiometric variation experiments to determine optimal complex formation
For genetic manipulation studies using CRISPR systems:
Include non-targeting gRNA controls
Use dCas fusion without activator domains
Implement mock-transformation controls
Measure expression of unrelated genes to confirm specificity
When encountering contradictory results in exbB-like 1 (sll0477) transport studies, researchers should apply the following methodological approach:
Systematic Comparison of Experimental Conditions:
Create a detailed table comparing all experimental variables (buffer composition, pH, temperature, protein preparation methods)
Identify systematic differences that might explain discrepancies
Conduct targeted experiments to test the impact of specific variables
Protein Conformational State Analysis:
Consider the possibility of multiple functional conformations
Proteins like exbB-like 1 may adopt different structures depending on pH, similar to how related ExbB proteins form different crystal forms at varying pH values
Use structural techniques like hydrogen-deuterium exchange mass spectrometry to identify condition-dependent conformational changes
Complex Formation Assessment:
Statistical Reanalysis:
Apply appropriate statistical tests to determine if differences are statistically significant
Consider using meta-analysis approaches to integrate conflicting datasets
Calculate effect sizes to quantify the magnitude of differences
Resolution Framework:
Design critical experiments that directly address contradictions
Implement collaboration with labs reporting different results
Consider that contradictory results may reflect biological reality rather than experimental error
For Binding Affinity Measurements:
Apply non-linear regression to fit binding curves to appropriate models (e.g., one-site binding, Hill equation)
Calculate Kd values with 95% confidence intervals
Use Scatchard or Hill plots to identify cooperative binding
Apply bootstrap resampling to estimate parameter uncertainty
For Co-Immunoprecipitation Studies:
Implement densitometry quantification across multiple biological replicates
Apply paired t-tests or ANOVA to compare different conditions
Use appropriate normalization to control for input variation
Calculate enrichment factors with appropriate error propagation
For FRET/BRET Interaction Studies:
Calculate FRET efficiency and transfer distance with error analysis
Distinguish specific from non-specific interactions using appropriate controls
Apply statistical tests comparing experimental FRET with random colocalization
Use Bland-Altman plots to compare different interaction measurement techniques
For Complex Stoichiometry Analysis:
Implement mixture modeling to identify distinct complex populations
Apply maximum likelihood estimation for stoichiometry determination
Calculate Bayesian information criterion to select optimal models
Use bootstrap methods to estimate confidence intervals for stoichiometry values
Data Visualization Recommendations:
Present individual data points alongside means and error bars
Use violin or box plots to show data distribution
Apply heat maps for multi-parameter interaction analyses
Implement hierarchical clustering to identify interaction patterns
Distinguishing specific from non-specific binding is critical when characterizing exbB-like 1 (sll0477) interactions. The following methodological approach is recommended:
Competitive Binding Analysis:
Perform binding assays in the presence of increasing concentrations of unlabeled competitors
Specific interactions will show concentration-dependent displacement
Calculate IC50 values to quantify binding specificity
Compare displacement profiles of related and unrelated competitors
Mutation Analysis:
Introduce site-directed mutations in predicted interaction interfaces
Compare binding of wild-type and mutant proteins
Create an alanine scanning library to map the complete interaction surface
Correlate binding changes with structural predictions
Control Protein Comparisons:
Compare binding of exbB-like 1 (sll0477) with structurally similar but functionally distinct proteins
Use scrambled or inverted peptide sequences as controls for peptide interactions
Implement heterologous proteins of similar size and charge properties as controls
Salt and pH Dependence Analysis:
Titrate salt concentration to distinguish electrostatic from hydrophobic interactions
Non-specific electrostatic interactions typically decrease with increasing ionic strength
Test binding across pH range to identify pH-dependent specific interactions
Create profiles of binding vs. salt concentration for specific and non-specific interactions
Kinetic Analysis:
Measure association and dissociation rates using techniques like surface plasmon resonance
Specific interactions typically have slower dissociation rates
Calculate kon and koff values to determine binding mechanisms
Use kinetic competition experiments to distinguish binding sites