Recombinant Synechocystis sp. Putative biopolymer transport protein exbB-like 1 (sll0477)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Synechocystis sp. Putative Biopolymer Transport Protein exbB-like 1 (sll0477)

Recombinant Synechocystis sp. Putative biopolymer transport protein exbB-like 1 (sll0477) is a protein that is produced using recombinant DNA technology in Synechocystis sp. (strain PCC 6803 / Kazusa) . Sll0477 is a gene name for this protein, which is also known as Putative biopolymer transport protein exbB-like 1 . Synechocystis sp. PCC 6803 is a model organism for studying photosynthesis, energy metabolism, and environmental stress .

Protein Information

  • Uniprot No: Q55834

  • Sequence Info: Full length protein with 254 amino acids

  • Expression Region: 1-254

Amino Acid Sequence

mLDNCKRLLFRKFPCFLSMAPSPLFLTQTPRLLDEFLKGGVVMFPLLLLSILALTTAFER
GWFWSRLLIQEDQVVRDVLDAAVEDLVKAREIAEHARHLAIGRFLLAPLKLRHPSPETFR
LAMEATADKEFARMRRGDKLLETIIALAPLLGLLGTVTGLIRTFNNLNIGGGGSSAEATQ
AASGIGEALITTAAGMMVAIFALLVFRVLVSLQSQQMDYFAAVGSELELIYREVWYEPHQ
PMPNLLMAARIAEP

Function and Characteristics

Sll0477 is similar to ExbB, a component of the TonB complex that is involved in the transport of biopolymers across the outer membrane in bacteria . Studies suggest that Sll0477 may play a role in the transport of exopolysaccharides (EPS) . EPS are important for cell sedimentation and protection against salt and metal stresses .

Role in Ethanol Production

During prolonged ethanol production in Synechocystis sp., the expression of sll0477 is altered . Specifically, transcriptomic analysis revealed the following changes in the expression of sll0477 under ethanol production:

Day 4Day 7Day 11Day 18
sll0477-as2-0.43-0.860.67-2.77

These values represent the log2 fold change in transcript levels .

Protein-Protein Interactions (PPIs)

Sll0477 is involved in protein-protein interactions (PPIs) within Synechocystis sp . It forms a stable association with pilus assembly proteins, Slr2015 and Slr2018, as well as with photosystem complexes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
sll0477; Putative biopolymer transport protein ExbB-like 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
sll0477
Target Protein Sequence
MLDNCKRLLFRKFPCFLSMAPSPLFLTQTPRLLDEFLKGGVVMFPLLLLSILALTTAFER GWFWSRLLIQEDQVVRDVLDAAVEDLVKAREIAEHARHLAIGRFLLAPLKLRHPSPETFR LAMEATADKEFARMRRGDKLLETIIALAPLLGLLGTVTGLIRTFNNLNIGGGGSSAEATQ AASGIGEALITTAAGMMVAIFALLVFRVLVSLQSQQMDYFAAVGSELELIYREVWYEPHQ PMPNLLMAARIAEP
Uniprot No.

Target Background

Function
This protein is involved in TonB-dependent energy-dependent transport of various receptor-bound substrates. It also protects ExbD from proteolytic degradation and functionally stabilizes TonB.
Database Links
Protein Families
ExbB/TolQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Synechocystis sp. Putative biopolymer transport protein exbB-like 1 (sll0477)?

Recombinant Synechocystis sp. Putative biopolymer transport protein exbB-like 1 (sll0477) is a full-length protein (254 amino acids) that functions as part of membrane transport systems in cyanobacteria. The protein is classified as a biopolymer transport protein based on sequence homology with other ExbB proteins that typically form complexes with ExbD to create energizing systems for various transport processes. In recombinant form, the protein is commonly expressed in E. coli with an N-terminal His-tag to facilitate purification and subsequent functional studies . The protein is encoded by the sll0477 gene in Synechocystis sp. and has the UniProt ID Q55834, which can be used to access comprehensive sequence information and predicted functional domains .

What are the structural characteristics of exbB-like 1 (sll0477)?

Recent structural studies of ExbB proteins, which are homologous to sll0477, have revealed that these proteins typically form hexameric complexes. X-ray crystallography and single-particle cryo-EM analyses have demonstrated that ExbB proteins organize into hexameric assemblies that interact with ExbD to create functional transport units .

The structural organization of exbB-like 1 (sll0477) includes:

  • Multiple transmembrane domains that anchor the protein within the cytoplasmic membrane

  • Cytoplasmic domains involved in energy transduction

  • Potential interaction surfaces for complex formation with partner proteins

Crystal structures of related ExbB proteins have been obtained under specific conditions (0.1 M glycine, pH 9.0, 0.15 M CaCl₂, ~40% PEG 350 MME, and 0.05–0.2 M L-arginine), resulting in plate-like crystals of approximately 100 μm × 100 μm × 10 μm that grow over 1–2 months . Hexagonal crystals were specifically observed in mother liquors at pH 5.4, suggesting pH-dependent structural arrangements that may have functional significance .

How is exbB-like 1 (sll0477) protein expressed and purified?

The methodological approach for expression and purification of recombinant exbB-like 1 (sll0477) typically follows this protocol:

  • Expression System: The protein is commonly expressed in E. coli using appropriate expression vectors containing the sll0477 gene fused to an N-terminal His-tag .

  • Purification Process:

    • Initial purification via metal affinity chromatography using the His-tag

    • For higher purity, researchers can implement a TEV protease cleavage site between the protein and His-tag

    • After His-tag binding, cleavage with TEV protease (3-hour incubation at room temperature)

    • Removal of imidazole by passing through a desalting column

    • Rebinding to metal affinity resin (1 hour at 4°C) to separate cleaved protein

    • Final purification by size exclusion chromatography (SEC)

  • Buffer Conditions: The protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

  • Storage Recommendations: For optimal stability, the protein should be stored at -20°C/-80°C with the addition of 5-50% glycerol (50% being common practice). Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

How does exbB-like 1 (sll0477) form complexes with other proteins?

ExbB proteins, including exbB-like 1 (sll0477), typically form complexes with ExbD proteins to create functional transport units. Recent structural studies have demonstrated that ExbB proteins organize into hexameric complexes that interact with ExbD . This interaction is critical for energy transduction during transport processes.

The complex formation process involves:

  • Assembly of ExbB monomers into a hexameric structure within the membrane

  • Association with ExbD components to form a complete ExbBD complex

  • Potential interactions with additional transport components specific to the substrates being transported

To study these interactions experimentally, researchers can:

  • Use pull-down assays with the His-tagged recombinant protein to identify interaction partners

  • Implement crosslinking approaches to capture transient interactions

  • Apply native mass spectrometry to determine complex stoichiometry

  • Utilize two-hybrid systems to validate specific protein-protein interactions in vivo

The functional significance of these complexes likely relates to creating energy-coupling mechanisms for transport processes, similar to TonB-dependent transport systems in other bacteria .

What crystallization methods are effective for exbB-like complexes?

Based on successful crystallization of related ExbB complexes, the following methodological approach is recommended:

  • Protein Preparation:

    • Concentrate the purified protein complex to approximately 10 mg/ml

    • Ensure high homogeneity through rigorous SEC purification

    • Verify complex stability through dynamic light scattering prior to crystallization attempts

  • Crystallization Conditions:

    • Implement extensive screening over sparse matrix conditions using automated systems (e.g., Mosquito crystallization robot)

    • Effective conditions include 0.1 M glycine, pH 9.0, 0.15 M CaCl₂, ~40% PEG 350 MME, and 0.05–0.2 M L-arginine

    • Use hanging-drop vapor diffusion at 20°C

    • Note that different crystal forms may be obtained at varying pH values (hexagonal crystals form at pH 5.4)

  • Crystal Growth Timeline:

    • Plate-like crystals of approximately 100 μm × 100 μm × 10 μm typically grow over a 1-2 month period

    • Hexagonal crystals may form under different pH conditions

  • Data Collection:

    • For membrane proteins like exbB-like 1, cryoprotection optimization is critical

    • X-ray diffraction data collection should be performed at synchrotron sources for optimal resolution

    • Complementary approaches like cryo-EM may be valuable for structural determination of larger complexes

How can CRISPR activation systems be used to study exbB-like 1 (sll0477) function?

CRISPR activation (CRISPRa) systems offer powerful tools for studying exbB-like 1 (sll0477) function through targeted upregulation of gene expression. Recent developments in CRISPRa for Synechocystis provide methodological approaches applicable to studying sll0477:

  • CRISPRa System Design:

    • Utilize dCas12a (R93A variant) fused to transcriptional activators like the E. coli SoxS with a 10-amino acid linker peptide

    • Express the fusion under control of inducible promoters like the rhamnose-inducible Prha promoter

    • Design gRNAs targeting specific regions of the sll0477 promoter

  • Target Site Selection:

    • The position of gRNA target sites relative to the transcription start site (TSS) critically impacts activation efficacy

    • Optimal positioning should be determined empirically through testing multiple gRNA positions

  • Transformation Protocol:

    • Prepare cargo E. coli strain with target plasmid and helper strain HB101 containing the pRL443-Amp^R plasmid

    • Grow overnight at 37°C in LB with appropriate antibiotics (50 μg/mL kanamycin for cargo strain; 100 μg/mL ampicillin for helper strain)

    • Centrifuge 1 mL of each E. coli strain and recipient Synechocystis (OD₇₅₀ ≈ 1.0) at 3,000 × g for 5 minutes

    • Resuspend in fresh media and combine cargo and helper strains

    • Wash twice in LB while washing Synechocystis cells twice in BG11

    • Combine 50 μL Synechocystis with the E. coli mixture and incubate at 30°C, 120 rpm, 50 μmol photons m⁻² s⁻¹ for 1.5-2 hours

    • Plate on nitrocellulose membranes on non-selective BG11 plates

    • Transfer membranes to selective plates after 20-24 hours and incubate until colonies form (5-7 days)

    • Verify transformants by colony PCR

  • Functional Analysis:

    • Use RT-qPCR to confirm upregulation of sll0477

    • Assess phenotypic consequences of overexpression

    • Perform complementary studies with CRISPRi (interference) to compare loss and gain of function

What techniques are recommended for studying exbB membrane topology?

Understanding the membrane topology of exbB-like 1 (sll0477) is critical for determining its functional mechanisms. The following methodological approaches are recommended:

  • Computational Prediction:

    • Apply multiple topology prediction algorithms (TMHMM, HMMTOP, Phobius)

    • Create a consensus model from multiple predictions

    • Identify potential transmembrane domains, cytoplasmic regions, and periplasmic loops

  • Experimental Verification:

    • Cysteine scanning mutagenesis: Introduce cysteine residues at various positions and assess accessibility to membrane-impermeant thiol-reactive reagents

    • PhoA/LacZ fusion analysis: Create fusion proteins with reporters that have activity dependent on cellular localization

    • Protease protection assays: Determine which regions are protected from proteolytic digestion in membrane preparations

    • Fluorescence resonance energy transfer (FRET): Assess proximity relationships between domains

  • Structural Studies:

    • Implement cryo-EM analysis of reconstituted complexes in nanodiscs or detergent micelles

    • Use hydrogen-deuterium exchange mass spectrometry to identify solvent-exposed regions

    • Apply crosslinking approaches to determine proximity relationships between domains

  • Data Integration:

    • Combine computational predictions with experimental results to create a comprehensive topology model

    • Compare with known structures of homologous proteins to identify conserved features

    • Correlate topology information with functional data to develop mechanistic models

What are optimal buffer conditions for maintaining exbB-like 1 (sll0477) stability?

Maintaining stability of membrane proteins like exbB-like 1 (sll0477) requires careful optimization of buffer conditions. Based on available data, the following methodological approach is recommended:

Buffer ComponentRecommended RangeRationale
Buffer TypeTris/PBS-basedProvides physiological pH range and ionic strength
pH7.5-8.0Optimal for stability while preventing aggregation
Stabilizing Agents6% TrehalosePrevents denaturation during freeze-thaw cycles
Storage Additive5-50% GlycerolCryoprotective agent preventing protein denaturation
Salt Concentration150-300 mM NaClReduces non-specific interactions
Reducing Agents1-5 mM DTT or 0.5-2 mM TCEPPrevents oxidation of cysteine residues
Protease InhibitorsCocktailPrevents degradation during storage

Additional considerations:

  • Storage Recommendations:

    • Aliquot protein to avoid repeated freeze-thaw cycles

    • Store long-term at -80°C

    • Working aliquots can be maintained at 4°C for up to one week

  • Reconstitution Guidelines:

    • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 50% for optimal stability

    • Centrifuge vials briefly before opening to bring contents to the bottom

  • Stability Monitoring:

    • Use dynamic light scattering to assess aggregation state

    • Apply differential scanning fluorimetry to determine thermal stability under varying conditions

    • Conduct activity assays to verify functional integrity after storage

How can researchers verify successful incorporation of exbB-like 1 (sll0477) into membrane models?

Verifying successful incorporation of exbB-like 1 (sll0477) into membrane models is crucial for functional studies. The following methodological approach is recommended:

What controls should be included in exbB-like 1 (sll0477) functional assays?

Robust functional assays for exbB-like 1 (sll0477) require appropriate controls to ensure validity and reproducibility. The following methodological controls are recommended:

Control TypePurposeImplementation
Negative ControlEstablish baseline/backgroundEmpty liposomes or membranes without exbB-like 1
Positive ControlValidate assay functionalityWell-characterized related transport protein
Inactive MutantConfirm specificitySite-directed mutants affecting key functional residues
Competitive InhibitionVerify transport specificityAddition of excess substrate to block specific transport
Temperature ControlsDistinguish active vs. passive processesPerform assays at 4°C vs. 30°C
Energy Coupling ControlsConfirm energy requirement+/- ATP, proton gradient, or other energy sources
Buffer ControlsRule out buffer artifactsVary buffer components systematically
Detergent ControlsAccount for detergent effectsTest various detergent concentrations
Directionality ControlsVerify transport directionInside-out vs. right-side-out membrane preparations
Time Course ControlsEstablish kineticsMultiple time points to establish transport rates

Additionally, when studying exbB-like 1 complexes with partner proteins:

  • Use individually expressed proteins as controls

  • Create interaction-deficient mutants to confirm specificity

  • Include stoichiometric variation experiments to determine optimal complex formation

For genetic manipulation studies using CRISPR systems:

  • Include non-targeting gRNA controls

  • Use dCas fusion without activator domains

  • Implement mock-transformation controls

  • Measure expression of unrelated genes to confirm specificity

How should researchers interpret contradictory results in exbB-like 1 (sll0477) transport studies?

When encountering contradictory results in exbB-like 1 (sll0477) transport studies, researchers should apply the following methodological approach:

  • Systematic Comparison of Experimental Conditions:

    • Create a detailed table comparing all experimental variables (buffer composition, pH, temperature, protein preparation methods)

    • Identify systematic differences that might explain discrepancies

    • Conduct targeted experiments to test the impact of specific variables

  • Protein Conformational State Analysis:

    • Consider the possibility of multiple functional conformations

    • Proteins like exbB-like 1 may adopt different structures depending on pH, similar to how related ExbB proteins form different crystal forms at varying pH values

    • Use structural techniques like hydrogen-deuterium exchange mass spectrometry to identify condition-dependent conformational changes

  • Complex Formation Assessment:

    • Determine if contradictory results stem from differences in complex formation

    • Verify complex stoichiometry under different experimental conditions

    • Consider that hexameric vs. pentameric assemblies may have different functions

  • Statistical Reanalysis:

    • Apply appropriate statistical tests to determine if differences are statistically significant

    • Consider using meta-analysis approaches to integrate conflicting datasets

    • Calculate effect sizes to quantify the magnitude of differences

  • Resolution Framework:

    • Design critical experiments that directly address contradictions

    • Implement collaboration with labs reporting different results

    • Consider that contradictory results may reflect biological reality rather than experimental error

What statistical approaches are recommended for analyzing exbB-like 1 (sll0477) interaction data?

  • For Binding Affinity Measurements:

    • Apply non-linear regression to fit binding curves to appropriate models (e.g., one-site binding, Hill equation)

    • Calculate Kd values with 95% confidence intervals

    • Use Scatchard or Hill plots to identify cooperative binding

    • Apply bootstrap resampling to estimate parameter uncertainty

  • For Co-Immunoprecipitation Studies:

    • Implement densitometry quantification across multiple biological replicates

    • Apply paired t-tests or ANOVA to compare different conditions

    • Use appropriate normalization to control for input variation

    • Calculate enrichment factors with appropriate error propagation

  • For FRET/BRET Interaction Studies:

    • Calculate FRET efficiency and transfer distance with error analysis

    • Distinguish specific from non-specific interactions using appropriate controls

    • Apply statistical tests comparing experimental FRET with random colocalization

    • Use Bland-Altman plots to compare different interaction measurement techniques

  • For Complex Stoichiometry Analysis:

    • Implement mixture modeling to identify distinct complex populations

    • Apply maximum likelihood estimation for stoichiometry determination

    • Calculate Bayesian information criterion to select optimal models

    • Use bootstrap methods to estimate confidence intervals for stoichiometry values

  • Data Visualization Recommendations:

    • Present individual data points alongside means and error bars

    • Use violin or box plots to show data distribution

    • Apply heat maps for multi-parameter interaction analyses

    • Implement hierarchical clustering to identify interaction patterns

How can researchers distinguish between specific and non-specific binding of exbB-like 1 (sll0477)?

Distinguishing specific from non-specific binding is critical when characterizing exbB-like 1 (sll0477) interactions. The following methodological approach is recommended:

  • Competitive Binding Analysis:

    • Perform binding assays in the presence of increasing concentrations of unlabeled competitors

    • Specific interactions will show concentration-dependent displacement

    • Calculate IC50 values to quantify binding specificity

    • Compare displacement profiles of related and unrelated competitors

  • Mutation Analysis:

    • Introduce site-directed mutations in predicted interaction interfaces

    • Compare binding of wild-type and mutant proteins

    • Create an alanine scanning library to map the complete interaction surface

    • Correlate binding changes with structural predictions

  • Control Protein Comparisons:

    • Compare binding of exbB-like 1 (sll0477) with structurally similar but functionally distinct proteins

    • Use scrambled or inverted peptide sequences as controls for peptide interactions

    • Implement heterologous proteins of similar size and charge properties as controls

  • Salt and pH Dependence Analysis:

    • Titrate salt concentration to distinguish electrostatic from hydrophobic interactions

    • Non-specific electrostatic interactions typically decrease with increasing ionic strength

    • Test binding across pH range to identify pH-dependent specific interactions

    • Create profiles of binding vs. salt concentration for specific and non-specific interactions

  • Kinetic Analysis:

    • Measure association and dissociation rates using techniques like surface plasmon resonance

    • Specific interactions typically have slower dissociation rates

    • Calculate kon and koff values to determine binding mechanisms

    • Use kinetic competition experiments to distinguish binding sites

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.