Recombinant Synechocystis sp. Putative biopolymer transport protein exbB-like 3 (sll1404)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Synechocystis sp. Putative Biopolymer Transport Protein exbB-like 3 (sll1404)

Recombinant Synechocystis sp. Putative biopolymer transport protein exbB-like 3, denoted by the gene locus sll1404, is a protein of interest in the field of biotechnology and microbiology. This protein is derived from the cyanobacterium Synechocystis sp. PCC 6803, a model organism widely used for studying photosynthesis, energy metabolism, and environmental stress responses . The recombinant form of this protein is produced in E. coli, which allows for its large-scale production and purification for various research applications.

Key Features:

  • Source: E. coli

  • Species: Synechocystis sp. (strain PCC 6803 / Kazusa)

  • Uniprot No.: P72604

  • Purity: >85% (SDS-PAGE)

  • Tag Info: The tag type is determined during the manufacturing process.

  • Protein Length: Partial

  • Storage Conditions: Liquid form has a shelf life of 6 months at -20°C/-80°C; lyophilized form has a shelf life of 12 months at -20°C/-80°C .

Potential Applications:

  • Biotechnology: Understanding biopolymer transport can aid in the development of novel bioproducts.

  • Environmental Studies: Insights into biopolymer transport may help in assessing environmental impacts of bioproducts.

Table 1: Characteristics of Recombinant Synechocystis sp. Putative Biopolymer Transport Protein exbB-like 3 (sll1404)

FeatureDescription
SourceE. coli
SpeciesSynechocystis sp. (strain PCC 6803 / Kazusa)
Uniprot No.P72604
Purity>85% (SDS-PAGE)
Tag InfoDetermined during manufacturing
Protein LengthPartial
Storage ConditionsLiquid: 6 months at -20°C/-80°C; Lyophilized: 12 months at -20°C/-80°C

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
sll1404; Putative biopolymer transport protein ExbB-like 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-210
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
sll1404
Target Protein Sequence
MAGGIVAVPLLGFSLLAVALIIERAYFWSQIQLRQNRLVNDVLKLYRSNPPGAIAKLKQN ADLPMARIFLEALCLEGATPTEFRLALESATQAELPLLKRFNTLFQTIITVSPLLGLLGT ILGLMRSFSSMSLGSTTAANASGVTGGISEALVSTVMGLVVAIATLLFANVFRSLYLRQF ALIQEQTGQIELVYRRFHDQPEEKEYATSR
Uniprot No.

Target Background

Function

Involved in TonB-dependent energy-dependent transport of various receptor-bound substrates. It protects ExbD from proteolytic degradation and functionally stabilizes TonB.

Database Links
Protein Families
ExbB/TolQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of the ExbB protein (sll1404) in Synechocystis sp. PCC 6803?

The ExbB protein (sll1404) in Synechocystis sp. PCC 6803 is a component of the ExbB-ExbD complex that plays a critical role in inorganic iron (Fe') uptake. Research has demonstrated that these complexes are essentially required for the Fe' transport process in cyanobacteria. Unlike the classical TonB-ExbB-ExbD system in other Gram-negative bacteria primarily involved in siderophore-mediated iron uptake, the ExbB-ExbD complex in Synechocystis appears to be directly involved in the acquisition of inorganic iron, which is an important adaptation for cyanobacteria inhabiting variable aquatic environments .

The involvement of ExbB-ExbD in inorganic iron uptake may allow cyanobacteria to more tightly maintain iron homeostasis, particularly in environments where iron concentrations fluctuate between limiting and sufficient levels. This mechanism represents an important evolutionary adaptation that distinguishes cyanobacterial iron acquisition from that of other bacteria .

How is sll1404 organized within the Synechocystis genome?

The sll1404 gene encoding the ExbB protein is organized in a gene cluster with sll1405, which encodes the ExbD protein. Together they form one of three exbB-exbD gene clusters present in the Synechocystis sp. PCC 6803 genome. The sll1404-sll1405 cluster is part of the iron-responsive Fur regulon, which is strongly induced under iron limitation conditions .

According to transcriptomic analyses, sll1404 (exbB) and sll1405 (exbD) are often co-transcribed as part of a functional operon. Expression analyses reveal that both genes are significantly upregulated during iron deprivation, with fold changes of approximately 4.23 for sll1404 and 4.15 for sll1405 under iron starvation conditions .

What experimental evidence supports the role of sll1404 in iron transport?

Multiple experimental approaches have established the role of sll1404 in iron transport:

  • Gene knockout studies: Mutation of exbB-exbD gene clusters results in reduced rates of iron uptake compared to wild-type cells .

  • Short-term iron uptake measurements: Experiments in chemically defined media demonstrate that iron uptake by Synechocystis depends on inorganic iron (Fe') concentration and requires functional ExbB-ExbD complexes .

  • Transcriptomic analyses: RNA sequencing studies show that sll1404 is significantly upregulated during iron starvation, with approximately 4-fold higher expression under iron-depleted conditions .

  • Regulon analysis: Genome-wide identification of Fur-binding sites indicates that sll1404-sll1405 is part of the Fur regulon, the primary regulator of iron homeostasis in cyanobacteria .

How can gene knockout mutants of sll1404 be generated and verified in Synechocystis sp. PCC 6803?

Generating knockout mutants of sll1404 involves a systematic approach taking advantage of the natural competence of Synechocystis sp. PCC 6803:

  • Construct design: Create a plasmid containing DNA fragments flanked by homologous sequences of sll1404, with an antibiotic resistance cassette replacing the target gene. Include the native promoter downstream of the antibiotic cassette to prevent unintended effects on downstream genes .

  • Assembly method: Employ Gibson Assembly for constructing the knockout plasmids. The vector backbone (e.g., pUC19) can be linearized using appropriate restriction enzymes such as XbaI and PstI .

  • Transformation: Transfer the constructed plasmid into Synechocystis by natural transformation, allowing for double homologous recombination .

  • Selection and verification: Select transformants on media containing the appropriate antibiotic. Verify successful gene replacement using colony PCR and subsequent sequencing .

  • Segregation analysis: Ensure complete segregation of the mutant genotype, as Synechocystis contains multiple genome copies. This typically requires several rounds of selection on antibiotic-containing media followed by PCR verification .

For complementation studies to validate phenotypes, introduce an intact copy of sll1404 into the mutant strain using a different selectable marker. For localization studies, GFP-tagged constructs can be generated to track protein expression and cellular distribution .

What expression systems are suitable for producing recombinant ExbB protein (sll1404) for biochemical studies?

For successful recombinant expression of the ExbB protein (sll1404) from Synechocystis, consider the following expression systems and optimization strategies:

  • E. coli-based expression:

    • Use E. coli BL21(DE3) or similar strains optimized for membrane protein expression

    • Construct vectors with inducible promoters (T7, tac, or arabinose-inducible)

    • Add affinity tags (His6, Strep-tag II) for purification, preferably with a cleavable linker

    • Express at lower temperatures (16-20°C) to enhance proper folding

    • Use specialized media (e.g., Terrific Broth or auto-induction media)

  • Cyanobacterial expression:

    • Use the native host (Synechocystis) for homologous expression

    • Employ the strong, light-regulated psbAII promoter (PpsbAII) for controlled expression

    • Integrate constructs into neutral genomic sites to avoid interference with endogenous functions

    • Add C-terminal or N-terminal tags for purification and detection

  • Membrane protein solubilization and purification:

    • Test various detergents (DDM, LDAO, Triton X-100) for optimal extraction

    • Employ gradient purification methods to maintain protein stability

    • Consider amphipol or nanodisc reconstitution for structural studies

  • Functional validation:

    • Assess iron transport capability using radiolabeled iron (55Fe) uptake assays

    • Verify complex formation with ExbD using co-immunoprecipitation or pull-down assays

    • Perform reconstitution experiments in liposomes to confirm transport function

When designing constructs, consider codon optimization based on the expression host and include TEV or PreScission protease cleavage sites for tag removal prior to structural or functional studies.

How can iron uptake be measured to assess the functional importance of sll1404?

To effectively measure iron uptake and evaluate the functional importance of sll1404 (ExbB) in Synechocystis sp. PCC 6803, implement the following methodological approaches:

  • Short-term iron uptake assays:

    • Use chemically well-defined media with controlled iron concentrations

    • Measure uptake rates as a function of free inorganic iron (Fe') concentration

    • Compare wild-type strains with sll1404 knockout mutants and complemented strains

    • Normalize uptake rates to cell number or chlorophyll content for accurate comparisons

  • Radioisotope-based measurements:

    • Employ 55Fe-labeled compounds for direct quantification of iron uptake

    • Calculate initial uptake rates under varying iron concentrations to determine kinetic parameters

    • Distinguish between iron bound to siderophores (e.g., ferrioxamine B) and inorganic iron forms

  • Comparative analysis of uptake mechanisms:

    • Compare uptake rates of inorganic iron versus siderophore-bound iron

    • Assess the relative ecological relevance of different iron acquisition pathways

    • For example, research has shown that at similar total iron concentrations, inorganic iron uptake is approximately 800-fold faster than hydroxamate siderophore iron uptake in Synechocystis

  • Long-term physiological measurements:

    • Monitor growth rates under varying iron concentrations

    • Assess chlorophyll content and photosynthetic activity as indicators of iron sufficiency

    • Measure intracellular iron content using spectroscopic methods or inductively coupled plasma mass spectrometry (ICP-MS)

  • Competition experiments:

    • Perform growth competition assays between wild-type and mutant strains under iron-limited conditions

    • Determine fitness consequences of sll1404 mutation in mixed cultures

By combining these approaches, researchers can comprehensively characterize the role of sll1404 in iron acquisition and better understand its importance for cyanobacterial physiology under varying environmental conditions.

How is the expression of sll1404 regulated in response to iron availability?

The expression of sll1404 (exbB) is tightly regulated in response to iron availability through a sophisticated regulatory network:

  • Fur-mediated regulation: The Ferric Uptake Regulator (Fur) acts as the master regulator of iron homeostasis in Synechocystis. Under iron-replete conditions, Fur binds to specific DNA motifs (Fur boxes) in the promoter regions of iron-responsive genes, including sll1404, repressing their transcription. Under iron-depleted conditions, Fur dissociates from the DNA, allowing transcription to proceed .

  • Transcriptional response to iron starvation: Transcriptomic studies have revealed that sll1404 expression is significantly upregulated during iron starvation. The table below shows the fold changes in sll1404 expression over multiple time points during iron deprivation:

Gene IDGene functional identificationFold change (times)
sll1404Biopolymer transport ExbB protein4.23
sll1405Biopolymer transport ExbD protein4.15

Data from transcriptomic analysis of iron deprivation response

  • Fur-binding consensus motif: Genome-wide analysis has identified a strong 23-nucleotide Synechocystis Fur-binding consensus motif in the promoter regions of iron-regulated genes, including the sll1404-sll1405 cluster. This motif serves as the recognition site for Fur-mediated regulation .

  • Co-regulation with other iron-responsive genes: sll1404 is co-regulated with other components of the iron acquisition machinery, including:

    • isiA (sll0247): Iron stress chlorophyll-binding protein (198.21-fold increase)

    • isiB (sll0248): Flavodoxin (64.72-fold increase)

    • tbdt genes (sll1206, sll1406): TonB-dependent siderophore receptors (12.34 and 10.27-fold increases, respectively)

This coordinated regulation ensures that all components necessary for efficient iron acquisition are simultaneously expressed under iron-limiting conditions, enabling Synechocystis to rapidly adapt to changes in iron availability in its environment.

What experimental approaches can be used to study the transcriptional regulation of sll1404?

To comprehensively investigate the transcriptional regulation of sll1404, researchers can employ the following experimental approaches:

  • RNA-Seq and transcriptome profiling:

    • Perform global transcriptome analysis under varying iron concentrations

    • Compare wild-type and fur mutant strains to identify Fur-dependent regulation

    • Map transcriptional start sites (TSSs) to precisely identify promoter elements

    • Previous studies have successfully used this approach to create transcript profiles of Synechocystis sp. PCC 6803 under various conditions including UV-B exposure and iron starvation

  • Promoter analysis and reporter assays:

    • Clone the sll1404 promoter region upstream of reporter genes (GFP, luciferase)

    • Introduce mutations in putative Fur-binding sites to validate their functionality

    • Measure reporter activity under varying iron concentrations

    • Use fluorescence microscopy or plate readers for quantitative analysis

  • Chromatin immunoprecipitation (ChIP):

    • Perform ChIP with anti-Fur antibodies to identify direct binding of Fur to the sll1404 promoter

    • Combine with high-throughput sequencing (ChIP-seq) for genome-wide binding profiling

    • Analyze binding patterns under iron-replete and iron-depleted conditions

  • Electrophoretic mobility shift assays (EMSA):

    • Use purified Fur protein and labeled DNA fragments containing the sll1404 promoter

    • Assess binding specificity using competitor DNAs and mutated binding sites

    • Determine the effect of iron concentration on Fur-DNA interactions

  • DNase I footprinting:

    • Precisely map the Fur-binding site in the sll1404 promoter region

    • Compare protected regions with the consensus Fur-binding motif

By combining these complementary approaches, researchers can build a detailed understanding of how sll1404 expression is regulated in response to iron availability and integrate this knowledge into the broader context of iron homeostasis in cyanobacteria.

How do the three ExbB-ExbD complexes in Synechocystis functionally differ, and is there specificity in their roles?

Synechocystis sp. PCC 6803 contains three exbB-exbD gene clusters (including sll1404-sll1405), raising intriguing questions about their functional differentiation:

Research has shown that these three ExbB-ExbD systems exhibit functional redundancy, but single and double mutants demonstrate reduced rates of iron uptake compared to wild-type cells. Notably, attempts to create a triple mutant appeared to be lethal, suggesting that at least one functional ExbB-ExbD complex is essential for viability .

To investigate the functional differences between these complexes, several experimental approaches can be implemented:

  • Comparative phenotypic analysis of single mutants:

    • Assess growth rates, pigmentation, and iron uptake capabilities of individual exbB-exbD knockout strains

    • Measure stress responses and adaptation to varying iron concentrations

    • Determine if specific complexes are preferentially expressed under different environmental conditions

  • Protein localization studies:

    • Use fluorescent protein tags to determine subcellular localization of each ExbB-ExbD complex

    • Investigate if the complexes are spatially segregated within the cell envelope

    • Employ super-resolution microscopy to visualize potential co-localization with other transport components

  • Targeted complementation experiments:

    • Cross-complement mutants (e.g., express sll1404-sll1405 in strains lacking the other exbB-exbD clusters)

    • Create chimeric proteins combining domains from different ExbB homologs

    • Determine if complexes can functionally substitute for each other

  • Interactome analysis:

    • Identify protein interaction partners for each ExbB-ExbD complex using co-immunoprecipitation

    • Perform crosslinking mass spectrometry to map interaction interfaces

    • Determine if the complexes associate with different TonB-like proteins or transport systems

Understanding the functional specialization or redundancy among these complexes will provide important insights into the evolution of iron acquisition mechanisms in cyanobacteria and may reveal novel aspects of membrane transport regulation.

What is the structural organization of the ExbB-ExbD complex containing sll1404, and how does it facilitate iron transport?

The structural organization of the ExbB-ExbD complex containing sll1404 remains an important area for investigation. Based on homology to better-characterized bacterial systems, the following structural hypotheses and research approaches can be considered:

  • Predicted structural features:

    • The ExbB protein (sll1404) likely forms a pentameric complex embedded in the cytoplasmic membrane

    • ExbD (sll1405) is expected to interact with ExbB through transmembrane domains

    • Together, they may form a channel or energy-transducing complex that facilitates iron transport

  • Structural biology approaches:

    • X-ray crystallography of purified ExbB-ExbD complexes

    • Cryo-electron microscopy to determine the quaternary structure

    • NMR spectroscopy for dynamic regions and protein-protein interactions

    • Site-directed spin labeling coupled with EPR spectroscopy to map conformational changes

  • Computational modeling:

    • Homology modeling based on solved structures of ExbB-ExbD from other organisms

    • Molecular dynamics simulations to predict conformational changes during transport

    • Protein-protein docking to model interactions with TonB-like proteins or substrate transporters

  • Functional mapping:

    • Systematic mutagenesis of conserved residues to identify critical functional domains

    • Accessibility studies using membrane-impermeable reagents

    • Disulfide crosslinking to map proximity relationships between complex components

  • Energy coupling mechanisms:

    • Investigate how proton motive force might be utilized by the complex

    • Determine if ATP hydrolysis plays a role in energizing transport

    • Identify potential conformational changes that might drive substrate translocation

Elucidating the structure-function relationship of the ExbB-ExbD complex will provide critical insights into the mechanism of iron transport in cyanobacteria and may reveal novel aspects of membrane transport systems that could be leveraged for biotechnological applications.

How does the ExbB-ExbD system (sll1404-sll1405) integrate with other iron homeostasis pathways in Synechocystis?

The ExbB-ExbD system (sll1404-sll1405) functions within a complex network of iron homeostasis pathways in Synechocystis. Understanding these interconnections represents an advanced research direction:

  • Integration with transcriptional regulatory networks:

    • Beyond Fur regulation, investigate potential roles of other transcription factors

    • Examine cross-talk with stress response pathways (oxidative stress, light stress)

    • Explore connections with regulatory small RNAs involved in iron homeostasis

  • Relationship with siderophore-based iron acquisition:

    • Although inorganic iron transport appears faster (approximately 800-fold) than siderophore-mediated uptake in Synechocystis, both systems may be important under different ecological conditions

    • Investigate if ExbB-ExbD complexes contribute to siderophore-based iron acquisition

    • Examine potential interactions with TonB-dependent receptors (e.g., sll1206, sll1406)

  • Coordination with iron storage mechanisms:

    • Study relationships between iron transport and iron storage proteins (bacterioferritins)

    • Investigate how cells balance iron uptake with storage to prevent toxicity

    • Examine iron allocation to different metabolic pathways (photosynthesis, respiration)

  • Role in iron-dependent metabolic remodeling:

    • Analyze how ExbB-ExbD-mediated iron uptake affects the expression of iron-containing proteins

    • Study the replacement of iron-containing proteins with non-iron alternatives during limitation

    • Investigate consequences for photosynthetic efficiency and electron transport

  • Connection to non-coding RNA regulators:

    • Small RNAs like IsaR1 are highly induced under iron starvation and regulate multiple target genes

    • Determine if there are feedback mechanisms between iron transport and sRNA regulation

    • Examine potential post-transcriptional regulation of exbB-exbD expression

This integrated view of iron homeostasis will provide a systems-level understanding of how cyanobacteria maintain iron balance in variable environments and may reveal novel regulatory mechanisms with implications for biotechnology and ecological modeling.

How can single-case experimental designs be applied to study sll1404 function in Synechocystis?

Single-case experimental designs (SCEDs) offer powerful approaches for studying the function of sll1404 in Synechocystis, particularly when investigating subtle phenotypic effects or dynamic responses:

  • Application of SCED principles to cyanobacterial research:

    • SCEDs provide flexible, viable alternatives to large sample size group designs

    • They allow for detailed observation of responses to specific manipulations over time

    • These designs are particularly valuable for studying genes with subtle or condition-specific phenotypes

  • SCED methodological framework for sll1404 studies:

    • Baseline sampling: Establish stable baseline measurements of growth, iron uptake, or gene expression before experimental manipulation

    • Intervention phase: Introduce specific conditions (iron limitation, oxidative stress) and monitor responses

    • Return to baseline: Remove the intervention and assess recovery patterns

    • Replication: Repeat the experimental cycle to establish reproducibility

  • Specific SCED designs applicable to sll1404 research:

    a. Multiple-baseline design:

    • Stagger the introduction of iron limitation across multiple independent cultures

    • Monitor sll1404 expression, iron uptake rates, and physiological parameters

    • Control for temporal effects unrelated to the experimental manipulation

    b. Alternating treatment design:

    • Alternate between iron-replete and iron-depleted conditions

    • Assess the dynamics of sll1404 expression and iron uptake during transitions

    • Compare responses between wild-type and mutant strains

    c. Changing criterion design:

    • Gradually decrease iron availability in defined increments

    • Determine thresholds for sll1404 induction and physiological responses

    • Characterize dose-response relationships in detail

  • Data analysis approaches:

    • Combine visual analysis (the traditional SCED approach) with statistical methods

    • Apply time-series analysis to characterize dynamic responses

    • Calculate effect sizes to quantify the magnitude of experimental manipulations

By applying these SCED principles to sll1404 research, investigators can gain detailed insights into the functional properties of this protein and its role in iron homeostasis, particularly under fluctuating environmental conditions.

What experimental design would be most appropriate to determine if sll1404 interacts with specific iron transport proteins?

To determine if sll1404 (ExbB) interacts with specific iron transport proteins in Synechocystis, a comprehensive experimental design combining in vivo and in vitro approaches would be most appropriate:

  • Protein-protein interaction screening:

    • Bacterial two-hybrid system:

      • Create fusion constructs of sll1404 with T25 domain and potential partners with T18 domain

      • Screen for interactions based on reconstitution of adenylate cyclase activity

      • Include positive controls (known interacting pairs) and negative controls

    • Split-GFP complementation assay:

      • Generate fusion proteins with split GFP fragments

      • Express in Synechocystis and monitor fluorescence restoration

      • Use confocal microscopy to determine subcellular localization of interactions

  • Co-immunoprecipitation coupled with mass spectrometry:

    • Create strains expressing epitope-tagged sll1404 (His-tag, FLAG-tag)

    • Perform pull-down experiments under varying iron conditions

    • Identify co-precipitating proteins by mass spectrometry

    • Validate key interactions with targeted Western blotting

  • Crosslinking coupled with mass spectrometry (XL-MS):

    • Apply in vivo crosslinking to capture transient interactions

    • Purify sll1404-containing complexes

    • Identify crosslinked peptides by mass spectrometry

    • Map interaction interfaces at amino acid resolution

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split a fluorescent protein (Venus, YFP) and fuse parts to sll1404 and candidate partners

    • Express in Synechocystis and monitor fluorescence

    • Analyze subcellular localization of interaction complexes

  • Surface Plasmon Resonance (SPR) or Microscale Thermophoresis (MST):

    • Purify recombinant sll1404 and potential interaction partners

    • Measure binding kinetics and affinities

    • Determine effects of iron concentration on interaction dynamics

  • Experimental controls and validation:

    • Generate and test interaction-deficient mutants based on identified interfaces

    • Perform competition assays with unlabeled proteins

    • Include unrelated membrane proteins as negative controls

    • Test interactions under varying iron availability conditions

This multi-faceted approach addresses the challenges of studying membrane protein interactions and provides complementary lines of evidence, increasing confidence in the identified interaction partners of sll1404 in the iron transport process.

How should transcriptomic data be analyzed to identify co-expressed genes with sll1404 under iron starvation?

For robust analysis of transcriptomic data to identify genes co-expressed with sll1404 under iron starvation, researchers should implement the following methodological approach:

  • Experimental design considerations:

    • Include multiple time points to capture the dynamics of gene expression changes

    • Use biological replicates (minimum of 3) for statistical robustness

    • Include appropriate controls (iron-replete conditions)

    • Consider related conditions (other metal limitations) to differentiate iron-specific responses

  • Data preprocessing and quality control:

    • Perform rigorous quality assessment of raw sequencing data

    • Apply appropriate normalization methods to account for technical variability

    • Remove batch effects if experiments were conducted in multiple sets

    • Use both absolute expression values and fold-changes for comprehensive analysis

  • Co-expression analysis methods:

    • Differential expression analysis:

      • Identify significantly regulated genes using tools like DESeq2 or edgeR

      • Apply appropriate statistical thresholds (adjusted p-value < 0.05)

      • Compare expression patterns across multiple time points

    • Clustering approaches:

      • Perform hierarchical clustering to group genes with similar expression patterns

      • Apply k-means or fuzzy c-means clustering to identify distinct response groups

      • Use self-organizing maps to visualize complex expression patterns

    • Network-based analysis:

      • Construct gene co-expression networks based on correlation metrics

      • Identify modules of highly interconnected genes using WGCNA or similar methods

      • Calculate network centrality measures to identify hub genes

  • Functional enrichment analysis:

    • Perform Gene Ontology (GO) enrichment analysis on co-expressed gene clusters

    • Analyze pathway enrichment to identify overrepresented biological processes

    • Use genome-scale metabolic models to contextualize gene expression changes

  • Integration with other data types:

    • Combine with ChIP-seq data to identify directly regulated genes

    • Integrate with proteomics data to assess correlation between transcript and protein levels

    • Incorporate metabolomics data to link gene expression changes to metabolic outcomes

  • Validation of key findings:

    • Confirm expression patterns of selected genes using RT-qPCR

    • Analyze promoter regions of co-expressed genes for shared regulatory elements

    • Examine conservation of co-expression relationships across related cyanobacterial species

By implementing this comprehensive analytical framework, researchers can reliably identify genes that are co-regulated with sll1404 during iron starvation and gain insights into the broader iron homeostasis network in Synechocystis.

How can contradictory data regarding sll1404 function be reconciled and interpreted?

When faced with contradictory data regarding sll1404 function, researchers should adopt a systematic approach to reconcile and interpret these discrepancies:

  • Methodological reconciliation:

    • Experimental conditions analysis:

      • Carefully compare growth conditions, media composition, and iron concentrations used in different studies

      • Consider differences in light intensity, temperature, or other environmental factors that might influence results

      • Evaluate whether studies were conducted under acute or chronic stress conditions

    • Strain background considerations:

      • Assess if different Synechocystis substrains were used (e.g., glucose-tolerant vs. non-tolerant)

      • Check for potential secondary mutations in laboratory strains

      • Consider if complete segregation was achieved in mutant strains

    • Methodological differences:

      • Compare assay sensitivities and detection limits

      • Evaluate time scales of measurements (short-term vs. long-term responses)

      • Consider whether direct or indirect measurements of function were employed

  • Data integration approaches:

    • Meta-analysis techniques:

      • Apply formal meta-analysis methods to quantitatively combine results from multiple studies

      • Weight evidence based on methodological rigor and sample sizes

      • Identify consistent trends across diverse experimental approaches

    • Bayesian integration:

      • Develop Bayesian models to incorporate prior knowledge and new data

      • Update confidence in hypotheses based on cumulative evidence

      • Identify the most probable explanations given all available data

  • Hypothesis reconciliation strategies:

    • Conditional functionality model:

      • Propose that sll1404 has different functions under different conditions

      • Design experiments to specifically test condition-dependent roles

      • Consider post-translational modifications that might alter protein function

    • Multifunctional protein hypothesis:

      • Investigate if sll1404 has multiple distinct roles beyond iron transport

      • Examine if it participates in different protein complexes under various conditions

      • Consider potential moonlighting functions in different cellular compartments

  • Experimental approaches for resolution:

    • Direct replication studies:

      • Repeat key experiments maintaining identical conditions to original studies

      • Involve multiple laboratories to ensure robustness

      • Implement blinded analysis to minimize bias

    • Integrative experimentation:

      • Design experiments that simultaneously measure multiple aspects of sll1404 function

      • Develop time-course studies to capture dynamic responses

      • Apply systems biology approaches to place contradictory results in broader context

By systematically applying these approaches, researchers can transform seemingly contradictory data into a more nuanced understanding of sll1404 function that accounts for its potential context-dependent roles in Synechocystis.

How does understanding sll1404 function contribute to our knowledge of cyanobacterial adaptation to iron limitation?

Understanding the function of sll1404 (ExbB) provides critical insights into cyanobacterial adaptation to iron limitation, with significant implications for environmental, evolutionary, and biotechnological research:

  • Ecological significance:

    • Iron limitation is a major constraint on cyanobacterial growth in many aquatic environments

    • The ExbB-ExbD system appears to be specialized for inorganic iron uptake, which may be more ecologically relevant than siderophore-mediated uptake in many habitats

    • Understanding this system helps explain how cyanobacteria maintain competitive fitness under fluctuating iron conditions in natural ecosystems

  • Evolutionary insights:

    • The presence of multiple ExbB-ExbD complexes in Synechocystis suggests functional specialization or redundancy that may reflect adaptation to variable environments

    • Although cyanobacteria possess outer membranes similar to Gram-negative bacteria, their cell envelopes show some Gram-positive characteristics, making their iron uptake systems evolutionarily distinct

    • Comparative genomic analyses of ExbB-ExbD systems across cyanobacterial lineages can reveal how iron acquisition mechanisms evolved in relation to habitat diversification

  • Physiological adaptation mechanisms:

    • The ExbB-ExbD system allows cyanobacteria to maintain iron homeostasis under variable conditions

    • Research shows that these complexes are essentially required for the Fe' transport process, highlighting their central role in iron acquisition

    • The system likely enables rapid responses to changing iron availability, crucial for maintaining photosynthetic efficiency

  • Molecular basis of stress responses:

    • Expression of sll1404 is significantly upregulated during iron starvation (4.23-fold increase)

    • This induction is part of a coordinated response involving multiple iron acquisition and metabolism genes

    • The ExbB-ExbD system functions within a broader network of iron homeostasis mechanisms, including regulatory sRNAs and transcription factors

Understanding sll1404 function provides a molecular window into how these ecologically important microorganisms adapt to iron limitation, a critical environmental challenge that has shaped their evolution and continues to influence their global distribution and ecological impacts.

What are the implications of sll1404 research for biotechnology applications using cyanobacteria?

Research on sll1404 (ExbB) and the ExbB-ExbD complex has several important implications for biotechnological applications using cyanobacteria:

By advancing our understanding of sll1404 and related iron transport systems, researchers can develop new strategies to overcome limitations in cyanobacterial biotechnology and enhance the commercial viability of these promising photosynthetic platforms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.