Recombinant Synechocystis sp. Putative serine protease HtrA (htrA)

Shipped with Ice Packs
In Stock

Description

Introduction

Synechocystis sp. PCC 6803, a cyanobacterium, employs protein-quality-control mechanisms to ensure survival in fluctuating and stressful environments . Among these mechanisms are serine proteases, including HtrA (high-temperature requirement A), HhoA (HtrA homologue A), and HhoB (HtrA homologue B), which are crucial for survival under high light and temperature stresses . These proteases may have overlapping physiological roles .

Characteristics of Recombinant HtrA Protease

Recombinant HtrA, along with HhoA and HhoB, can degrade unfolded model substrates, but they differ in cleavage sites, temperature, and pH optima .

ProteasepH OptimumTemperature OptimumActivation by Divalent Ions
HtrAAcidic33°CYes
HhoASlightly Acidic to Alkaline (in the presence of Mg2+ and Ca2+ ions)Up to 55°CYes
HhoBNANAYes
*HtrA activity is highest at the optimal growth temperature of Synechocystis (33°C) and decreases slowly with raised temperature . The addition of Ca2+ or Mg2+ strongly enhances the proteolytic activity of HtrA .

Oligomerization and PDZ Domain

HtrA, HhoA, and HhoB form different homo-oligomeric complexes with and without substrate, suggesting mechanistic differences compared to each other and Escherichia coli orthologues DegP and DegS . The PDZ domain is important for the biological functions and interactions of HtrA . Deletion of the PDZ domain decreases, but does not abolish, the proteolytic activity of HtrA and prevents substrate-induced formation of complexes larger than trimers . HtrA depleted of the PDZ domains will only be present in trimeric form and lose the ability to form larger oligomers, even when a substrate is present .

Role in Stress Response

The HtrA family of proteases is involved in protecting Synechocystis PCC 6803 from light stress and participates in the repair of photosystem II (PSII) . A triple mutant (ΔhtrA/hhoA/hhoB) showed inhibited growth on agar plates at high light intensities, particularly with glucose . Under high light conditions, the rate of synthesis of functional PSII was lower in the mutant than in the wild-type, and the degradation of D1 was slowed in the mutant . HtrA functions in cellular tolerance against photosynthetic stress and might act as a protease partner of HhoB, generating a protease/chaperone complex .

Genetic and Molecular Studies

Recombinant truncated Syn_Degs were constructed as His-tagged versions lacking the predicted signal peptide (for rHhoA and rHhoB) or transmembrane domain (for rHtrA) . Single deg mutants (ΔhhoA, ΔhhoB, and ΔhtrA) were generated by replacing a fragment in the middle of each individual deg gene . Site-directed mutagenesis was used to create proteolytically inactive variants by changing the active-site serine residues to alanine . For example, the codon for Ser 296 of rHtrA was mutated to alanine (rHtrASA) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
htrA; slr1204; Putative serine protease HtrA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-452
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
htrA
Target Protein Sequence
MSAQAVFPIAPHRADFFPRFVLSNSSANKCHQAMKDVSLHSPKQTPSKISLAYLGLVLVG MGIGAGGTFVLTNPQWADHLTNNSVISPLVTNQSIAPANESLATNLQSRLSPREPSNFVV DVVESTGPAVVRINAQKTVKSQVPQAFNDPFLQRFFGSQMPPMPNERVQRGTGSGFIVSN DGKIFTNAHVVDGADEVTVTLKDGRSFPGRVMGSDPSTDVAVVKIEAGDLPTVALGDSDH LQVGEWAIAIGNPLGLDNTVTTGILSATGRRSADIGVPDKRVEFIQTDAAINPGNSGGPL LNADGQVIGMNTAIIQNAQGIGFAIPINKAQEIAQQLIATGKVEHAYLGIQMVTMTPELQ SQIRQETGMNIPVDKGVVIMQVMPNSPAAIAKLEQGDVLQSLQGQPVENAEQVQSLVGKL AVGDEVELGILRNGQQQNLTVTIGALPSAPPQ
Uniprot No.

Target Background

Function

A putative serine protease; its function shows overlap with the related putative proteases HhoA and HhoB.

Database Links
Protein Families
Peptidase S1C family
Subcellular Location
Cell outer membrane; Single-pass membrane protein.

Q&A

What is HtrA protease in Synechocystis sp. PCC 6803?

HtrA (high temperature requirement A) is one of three serine proteases in the cyanobacterium Synechocystis sp. PCC 6803, alongside HhoA (HtrA homologue A) and HhoB (HtrA homologue B). It functions as an ATP-independent serine endopeptidase with a characteristic C-terminal PDZ domain, playing a critical role in protein quality control mechanisms . This protease is essential for survival under high light and temperature stresses, functioning within stress response pathways by maintaining protein stability and protecting cells against environmental stressors . The Synechocystis HtrA also participates in the unfolded protein response (UPR) similar to its homologs in other organisms .

How does the structure of HtrA differ from other Deg/HtrA proteases in Synechocystis?

HtrA differs structurally from HhoA and HhoB in several key aspects:

  • Membrane association: HtrA possesses a membrane anchoring domain rather than a signal peptide like HhoA and HhoB .

  • Oligomeric complexes: HtrA forms distinct homo-oligomeric complexes compared to HhoA and HhoB, both in the presence and absence of substrates .

  • Domain organization: While all three proteases contain a PDZ domain, their interaction with substrates and resultant conformational changes differ significantly .

When the PDZ domain is deleted, HtrA shows decreased but not abolished proteolytic activity, and substrate-induced formation of complexes higher than trimers is prevented, indicating a distinct regulatory mechanism compared to its paralogs .

What is the cellular localization of HtrA protease in Synechocystis?

HtrA in Synechocystis sp. PCC 6803 is primarily associated with membrane fractions. Specifically:

  • HtrA has been identified in the plasma membrane fraction .

  • It has also been detected in the thylakoid membrane fraction .

  • Unlike previous reports suggesting presence in the outer membrane, more recent studies indicate HtrA might be anchored to the plasma membrane on the periplasmic side, similar to its E. coli homolog DegS .

  • In Synechocystis, the thylakoid lumen and periplasmic space are continuous, suggesting HtrA could potentially interact with components in both compartments .

This localization pattern suggests strategic positioning to monitor and maintain protein quality in membrane systems critical for photosynthesis and cellular homeostasis.

What are the optimal methods for recombinant expression of functional HtrA protease?

For successful recombinant expression of Synechocystis HtrA:

  • Expression system: Escherichia coli has proven effective for expressing recombinant HtrA with >85% purity .

  • Construct design: The optimal construct should:

    • Exclude the N-terminal transmembrane domain to enhance solubility

    • Include a His-tag for purification

    • Target amino acid residues 33-393 for full catalytic activity

  • Purification approach:

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Follow with size exclusion chromatography to separate functional oligomeric states

For monitoring activity, both SDS-PAGE and Western blotting methods are suitable for the recombinant protein . Creating catalytically inactive versions by mutating the catalytic Ser residue to Ala provides valuable negative controls for functional studies .

How can researchers assess HtrA substrate specificity and activity?

To characterize HtrA substrate specificity and activity:

  • In vitro proteolytic assays:

    • Use unfolded model substrates such as β-casein or resorufin-labeled casein

    • Monitor cleavage over time at varying temperature and pH conditions

    • Analyze cleavage sites via mass spectrometry to determine sequence preferences

  • pH and ion dependence analysis:

    • Test activity across pH range 5.0-9.0

    • Include assays with Mg²⁺ and Ca²⁺ ions, which can shift pH optima (particularly relevant for HhoA and to a lesser extent for HtrA)

  • Substrate identification approaches:

    • N-terminal COFRADIC (COmbined FRActional DIagonal Chromatography) to identify natural substrates

    • Comparative proteomic analysis between wild-type and ΔhtrA mutant strains

  • Oligomerization studies:

    • Size exclusion chromatography to monitor complex formation with/without substrate

    • Analysis of PDZ domain contribution by comparing wild-type and PDZ-deleted variants

How do the biochemical characteristics of the three Synechocystis Deg/HtrA proteases compare?

The three Deg/HtrA proteases in Synechocystis show distinct biochemical properties that suggest specialized functional roles:

PropertyHtrAHhoAHhoB
Temperature optimumDistinct optimal rangeDifferent from HtrA and HhoBDifferent from HtrA and HhoA
pH optimumMild shift to alkaline in presence of Mg²⁺/Ca²⁺Significant shift from acidic to alkaline with Mg²⁺/Ca²⁺Less affected by ions
Oligomeric stateForms specific homo-oligomeric complexesDifferent oligomeric pattern than HtrADistinct oligomerization pattern
PDZ domain effectDeletion decreases activity and limits complex formationDeletion decreases activity and prevents higher order complexesDeletion decreases activity but with different pattern
Identified substratesPsbO, Pbp8RbcSPsbO
Cleavage site preferenceDistinct sequence preferenceDifferent from HtrADifferent from HtrA and HhoA

These differences highlight that while these proteases may have overlapping functions, they likely have evolved distinct substrate preferences and regulatory mechanisms to address specific cellular needs .

What are the potential mechanistic differences between Synechocystis HtrA and E. coli Deg proteases?

Synechocystis HtrA shows several mechanistic differences compared to its well-studied E. coli orthologs DegP and DegS:

These differences likely reflect evolutionary adaptations to the specific needs of cyanobacteria, particularly related to photosynthetic function and stress response.

How does HtrA contribute to stress resistance in Synechocystis sp. PCC 6803?

HtrA plays crucial roles in several stress response mechanisms:

  • High light stress protection:

    • HtrA is essential for survival under high light conditions

    • It appears to protect photosynthetic components from light-induced damage

    • Mutants lacking HtrA show increased sensitivity to high light stress

  • Temperature stress defense:

    • As suggested by its name (high temperature requirement A), HtrA is critical during heat stress

    • It likely prevents accumulation of misfolded proteins during thermal stress

  • Protein quality control:

    • HtrA monitors and degrades misfolded proteins before they can aggregate and become toxic

    • This function is especially important under dynamic environmental conditions that cyanobacteria experience

  • Specialized metabolic contributions:

    • Beyond direct stress protection, HtrA contributes to stabilizing important physiological processes including polysaccharides biosynthesis and peptidoglycan turnover

The multifaceted stress resistance functions of HtrA highlight its importance in maintaining cellular homeostasis under adverse environmental conditions.

What is the specific role of HtrA in photosystem II repair mechanisms?

HtrA plays a critical role in the protection and repair of photosystem II (PSII):

  • PSII damage prevention:

    • HtrA helps protect PSII components from light-induced damage

    • This protective function is especially important under high light conditions

  • D1 protein turnover:

    • PSII is prone to irreversible light-induced damage, with the D1 polypeptide being a major target

    • Repair processes operate to replace damaged D1 subunits with newly synthesized copies

    • HtrA appears to be involved in this repair cycle

  • PsbO substrate interaction:

    • Proteomic studies have identified PsbO (a key component of the oxygen-evolving complex of PSII) as a natural substrate for HtrA

    • This suggests HtrA may regulate PSII function through controlled proteolysis of PsbO

  • Coordination with other proteases:

    • HtrA works alongside the other Deg proteases (HhoA and HhoB) in PSII maintenance

    • HhoB also targets PsbO, suggesting potential functional redundancy or cooperation in this specific aspect

These functions position HtrA as a key player in maintaining photosynthetic efficiency, particularly under stress conditions that accelerate PSII damage.

How can researchers distinguish between redundant and unique functions of the three Deg/HtrA proteases?

Distinguishing the overlapping yet distinct functions of HtrA, HhoA, and HhoB requires multi-faceted approaches:

  • Single and multiple knockout studies:

    • Compare phenotypes of single knockout mutants (ΔhtrA, ΔhhoA, ΔhhoB)

    • Create double and triple knockouts to identify synergistic effects

    • Assess growth rates, stress tolerance, and specific metabolic parameters across growth conditions

  • Complementation experiments:

    • Express one protease in the background of another's deletion

    • Determine if normal phenotype is restored, indicating functional redundancy

    • Use domain-swap experiments to identify which domains confer specific functions

  • Substrate identification approaches:

    • Use N-terminal COFRADIC and comparative proteomics to identify natural substrates specific to each protease

    • Perform in vitro assays with purified proteases and potential substrates

    • Compare substrate profiles across different stress conditions

  • Localization studies:

    • Use membrane fractionation and immunoblotting to determine precise subcellular localization

    • Create GFP fusions to visualize potential relocalization under stress conditions

    • Compare localization patterns between the three proteases

  • Expression pattern analysis:

    • Monitor protease expression levels under various stress conditions

    • Analyze if expression of one protease changes in response to deletion of another

    • This may reveal compensatory regulation mechanisms

Research has shown that protein expression of the remaining Deg/HtrA proteases is strongly affected in single insertion mutants, suggesting interconnected regulatory networks .

What are the most promising research directions for understanding HtrA function in cyanobacteria?

Several promising research avenues may significantly advance our understanding of HtrA function:

  • Structural biology approaches:

    • Determine high-resolution structures of Synechocystis HtrA in different activation states

    • Compare with HhoA and HhoB structures to identify unique features

    • Analyze substrate-bound complexes to understand recognition mechanisms

  • Systems biology integration:

    • Combine transcriptomics, proteomics, and metabolomics to build comprehensive models of HtrA function

    • Map interaction networks and regulatory circuits involving HtrA

    • Identify connections between HtrA and global stress response pathways

  • Environmental adaptation studies:

    • Investigate how HtrA function varies across different cyanobacterial species from diverse habitats

    • Determine if HtrA properties correlate with environmental niche adaptation

    • This may reveal evolutionary adaptations of protein quality control mechanisms

  • Regulatory mechanism exploration:

    • Identify factors that regulate HtrA expression and activity

    • Investigate post-translational modifications that might modulate HtrA function

    • Study the interplay between HtrA and other quality control systems

  • Biotechnological applications:

    • Explore how engineering HtrA might improve cyanobacterial stress tolerance

    • Investigate applications in improving photosynthetic efficiency

    • Consider potential applications in biofuel production or other sustainable technologies

These research directions could substantially expand our understanding of protein quality control in photosynthetic organisms while potentially yielding applications in synthetic biology and biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.