Recombinant Synechocystis sp. Putative zinc metalloprotease sll0528 (sll0528)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

Recombinant Sll0528 has been expressed in multiple heterologous systems:

Expression SystemPurityApplicationSource
E. coli BL21(DE3)≥85%Protease activity assays
Yeast/Baculovirus≥85%Structural studies
Mammalian cells≥85%Functional characterization

The protein is purified using GST affinity chromatography, ensuring high yield and specificity . Cell-free expression systems are also employed for rapid production .

In Vitro Proteolytic Activity

Recombinant Sll0528 demonstrates robust proteolytic activity against β-casein in time-dependent assays :

  • Substrate: β-casein cleaved into fragments of 25–30 kDa.

  • Optimal conditions:

    • pH: 8.0 (Tris-acetate buffer).

    • Cofactors: 5 mM Mg-acetate, 12.5 µM Zn-acetate .

  • Inhibitors: Activity is blocked by o-phenanthroline (metal chelator) but unaffected by serine/cysteine protease inhibitors .

Biological Role in Stress Response

Knockout studies in Synechocystis sp. PCC 6803 reveal Sll0528’s critical role in stress acclimation:

Stress-Induced Gene Expression

Stress ConditionInduction (Fold)Peak Time
Salt (854 mM NaCl)>50x4–6 h
Hyperosmotic (0.5 M sorbitol)100x0.25 h
Cold (4°C)>100x2–4 h
High light~10x0.25 h

The sll0528 mutant exhibits:

  • Retarded growth under salt, cold, and hyperosmotic stress .

  • Reduced chlorophyll content and disrupted photosystems .

  • No phenotype under high light or mixotrophic conditions, indicating stress-specific functionality .

Comparative Analysis with Other S2Ps

Sll0528 is the most stress-responsive S2P in Synechocystis, outperforming homologs like Slr0643 and Sll0862:

  • Salt stress: 50x induction vs. <3x for other S2Ps .

  • Catalytic efficiency: Higher β-casein cleavage activity compared to non-stress-induced S2Ps .

Research Applications

  • Stress signaling studies: Used to dissect proteolytic cascades in cyanobacterial stress responses .

  • Biotechnological tool: Potential applications in bioengineering stress-tolerant cyanobacteria .

  • Enzymatic assays: Serves as a model for studying metalloprotease mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery details, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference for your own preparations.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize the development of the specified tag.
Synonyms
sll0528; Putative zinc metalloprotease sll0528
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-379
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
sll0528
Target Protein Sequence
MLSLSLGGQFMNNNIRVGSLFGIPFYVNPSWFLILGLVTLSYGQDLARFPQLSGGTPWIL GLITALLLFASVVAHELGHSLVALAQGIEVKSITLFLFGGLASLEKESNTPWQAFAVAIA GPAVSLVLFLGLTIVGTQIPLPVPGQAIIGLLGMINLALALFNLIPGLPLDGGNVLKSIV WQITGNQNKGILIASRVGQGFGWLAIAIGSLGILNILPIGSFWTILIGWFLLQNAGSSAR NAQVKEQMEAFTAEDAVIPNSPIIPAGLNIREFANDYVIGKTPWRRFLVIGADNQLLGVL ATEDIKHVPTSDWPQVTVDSLMQYPQQMVTVNANQSLFEVAQLLDQQKLSELLVVQPSGE VVGLLEKASIIKCLQTSAA
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M50B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Sll0528 and what is its role in Synechocystis sp. PCC 6803?

Sll0528 is a site-2-protease (S2P) found in the cyanobacterium Synechocystis sp. PCC 6803. It functions as a metalloprotease that plays a crucial role in stress response mechanisms. Research has demonstrated that Sll0528 is particularly important for acclimation to salt, cold, and hyperosmotic stress conditions. The protein mediates proteolysis of transmembrane transcriptional regulators, which is a conserved mechanism for regulating transmembrane signaling in many organisms. S2P homologs are universally present across different cyanobacterial genomes, suggesting their conserved and fundamental functions in these organisms .

How is the expression of sll0528 regulated under different stress conditions?

The sll0528 gene shows remarkable induction patterns under various stress conditions, with distinct expression profiles:

  • Under salt stress (854 mM NaCl): Expression increases continuously from 0.25 to 6 hours, reaching more than 50-fold upregulation at 4-6 hours post-exposure .

  • Under hyperosmotic stress (0.5 M sorbitol): Expression peaks rapidly at approximately 100-fold induction at 0.25 hours before gradually returning to basal levels by 6 hours .

  • Under cold stress (4°C): Massive induction occurs with more than 100-fold upregulation between 1-6 hours, peaking at 2-4 hours .

  • Under high light (200 μmol·photons·m⁻²·s⁻¹): A relatively modest and transient ~10-fold induction occurs at 0.25 hours, with expression returning to basal levels around 2 hours .

  • Under mixotrophic growth conditions (2.5 mM glucose): A small, transient induction occurs, peaking at 9-fold at 0.5 hours before returning to basal levels by 4 hours .

Notably, the induction of sll0528 under stress conditions is significantly higher than that of other S2P genes (slr0643, sll0862, and slr1821) in Synechocystis, indicating its particular importance in stress response mechanisms .

What evidence supports Sll0528's function as a metalloprotease?

Several experimental findings support Sll0528's classification as a metalloprotease:

  • Recombinant GST-Sll0528 protein demonstrates proteolytic activity against beta-casein in vitro, cleaving it into smaller fragments in a time-dependent manner .

  • This proteolytic activity is not inhibited by Complete EDTA-free (a cocktail of serine and cysteine protease inhibitors), indicating it's neither a serine nor cysteine protease .

  • The activity is inhibited by o-phenanthroline, a metal chelator, supporting its classification as a metalloprotease .

  • Sequence analysis identifies Sll0528 as a site-2-protease, a known class of membrane-embedded metalloproteases.

The combined biochemical and genetic evidence strongly supports Sll0528's function as a metalloprotease involved in stress response regulation in Synechocystis .

What phenotypes are observed when sll0528 is knocked out?

Knockout of the sll0528 gene results in several distinct phenotypes, particularly under stress conditions:

Under salt stress:

  • Significantly reduced growth rate compared to wild type

  • Severely reduced pigmentation, particularly chlorophyll and phycocyanin

  • Disrupted photosystems with decreased PSI/PSII ratio

  • Inability to grow at salt concentrations that are tolerated by wild type

Under hyperosmotic stress (0.5 M sorbitol):

  • More severely impeded growth compared to wild type

  • Dramatic reduction in chlorophyll, carotenoids, and phycocyanin

  • Nearly flat absorption spectra indicating severe loss of photosynthetic pigments

  • Severely impaired photosystems

Under cold stress (4°C):

  • Completely halted growth

  • Significantly bleached appearance

  • Substantially reduced photosynthetic pigments

Under normal growth conditions, high light, and mixotrophic growth:

  • No significant difference between the knockout mutant and wild type, suggesting Sll0528 is dispensable under these conditions

These phenotypes collectively demonstrate that Sll0528 is indispensable for acclimation to salt, cold, and hyperosmotic stress but not required for normal growth, high light response, or mixotrophic growth .

How does membrane rigidification affect sll0528 induction?

Membrane rigidification appears to play a significant role in sll0528 induction, particularly under cold stress. Research using Fourier transform infrared spectrometry has shown that lipids in plasma membranes become rigidified as temperature decreases. The cold inducibility of sll0528 is enhanced when membrane lipids are further rigidified by knocking out fatty acid desaturases .

This suggests a potential mechanism where membrane rigidity serves as a physical signal that triggers sll0528 expression. The relationship between membrane fluidity and sll0528 expression explains why cold stress (which significantly increases membrane rigidity) triggers some of the highest induction levels observed for this gene. The enhanced sensitivity of sll0528 to temperature decreases implies its active role in cold stress acclimation and suggests that membrane physical properties may be an important factor in regulating S2P activity in cyanobacteria .

How does Sll0528 compare to other S2Ps in cyanobacteria?

Synechocystis sp. PCC 6803 contains four S2P homologs: Sll0528, Slr0643, Sll0862, and Slr1821. Among these, Sll0528 shows the most dramatic induction under various stress conditions:

S2PSalt StressHyperosmotic StressCold StressHigh LightMixotrophic Growth
Sll0528>50-fold~100-fold>100-fold~10-fold~9-fold
Slr0643<3-foldMinimalMinimal<1.6-foldMinimal
Sll0862<3-foldMinimalSmall but significant<1.6-foldMinimal
Slr1821<3-fold~5.5-foldSmall but significant<1.6-foldMinimal

The remarkable stress-specific induction of sll0528 compared to other S2Ps suggests it plays a specialized role in stress response, while other S2Ps might have different physiological functions or respond to different types of stimuli not explored in the available research .

What are the potential mechanisms by which Sll0528 mediates stress responses?

While the exact molecular mechanisms remain to be fully elucidated, several potential pathways can be proposed based on current research:

  • Regulated Intramembrane Proteolysis (RIP): As a site-2-protease, Sll0528 likely participates in RIP, where it cleaves membrane-bound transcription factors or regulatory proteins, releasing active domains that can then influence gene expression .

  • Integration with known stress response pathways: Sll0528 may interact with established salt and osmotic stress response mechanisms in cyanobacteria, including:

    • Two-component regulatory systems (Hik/Rre-pairs)

    • Transcription factors

    • RNA polymerase sigma factors (σ)

    • Systems involved in active extrusion of toxic inorganic ions

    • Pathways for accumulation of compatible solutes

    • Exopolysaccharide production mechanisms

  • Membrane integrity maintenance: The correlation between membrane rigidification and sll0528 induction suggests it may play a role in maintaining membrane function and integrity during stress conditions .

  • Photosystem protection or repair: The severely impaired photosystems in sll0528 knockout mutants under stress conditions suggest it may be involved in protecting or repairing photosynthetic machinery during stress .

The research indicates that functional Sll0528 protein is crucial for efficient stress acclimation, but further studies are needed to determine how it cooperates with known sensors and signal transducers in the stress response network .

How can researchers effectively express and characterize recombinant Sll0528?

Based on successful approaches documented in the literature, researchers can express and characterize recombinant Sll0528 using the following methodology:

  • Expression construct preparation:

    • Generate a GST-Sll0528 fusion construct for expression in E. coli

    • Ensure the construct includes the catalytic domains necessary for protease activity

    • Include appropriate affinity tags for purification (GST tag has been successfully used)

  • Expression and purification:

    • Express in an E. coli expression system

    • Purify using affinity chromatography based on the fusion tag

    • Include controls (such as GST-only protein) for subsequent activity assays

  • Activity characterization:

    • Use beta-casein as a model substrate to test proteolytic activity

    • Perform time-dependent degradation assays to demonstrate progressive substrate cleavage

    • Include control reactions with other recombinant proteins to confirm activity is specific to Sll0528

  • Inhibitor profiling:

    • Test with protease inhibitor cocktails (e.g., Complete EDTA-free) to rule out serine and cysteine protease activity

    • Use metal chelators (e.g., o-phenanthroline) to confirm metalloprotease activity

    • Test with various metal ions to determine cofactor requirements

  • Substrate specificity analysis:

    • Test against various protein substrates to determine specificity

    • Analyze cleavage products using SDS-PAGE or mass spectrometry

    • Map cleavage sites to identify sequence preferences

This methodological approach allows researchers to confirm the proteolytic activity of recombinant Sll0528 and characterize its enzymatic properties in vitro .

What techniques are effective for generating and validating sll0528 mutants?

Based on successful approaches documented in the literature, an effective protocol for generating and validating sll0528 knockout mutants includes:

  • Construct preparation:

    • Amplify upstream and downstream fragments of the sll0528 gene using PCR with appropriate primers (e.g., primers P1/P2 and P3/P4 as indicated in the research)

    • Clone these fragments into a suitable vector (e.g., pET-30b(+)) using appropriate restriction enzymes (XhoI/SacI for upstream and BamHI/NdeI for downstream fragments)

    • Insert an antibiotic resistance cassette (e.g., chloramphenicol resistance cassette from pACYC184) between the upstream and downstream fragments

  • Transformation and selection:

    • Transform the construct into Synechocystis sp. PCC 6803

    • Select transformants under photoautotrophic growth conditions with appropriate antibiotic (e.g., chloramphenicol at 40 μg·mL⁻¹)

    • Perform multiple rounds of selection to achieve complete segregation of the mutant genotype

  • Verification of mutants:

    • PCR verification: Use primers spanning the insertion site to confirm the replacement of sll0528 with the antibiotic resistance cassette

    • Sequencing of PCR products to confirm the correct insertion

    • Thermal asymmetric interlaced PCR (TAIL-PCR) to confirm the flanking regions of the inserted cassette

    • RT-PCR to confirm the absence of sll0528 transcripts in the mutant

  • Phenotypic characterization:

    • Compare growth rates of wild type and mutant under normal and stress conditions

    • Analyze whole-cell absorption spectra to assess photosynthetic pigments

    • Measure chlorophyll content

    • Analyze fluorescence properties of photosystems using 77K fluorescence spectroscopy

This comprehensive approach ensures the generation of completely segregated sll0528 knockout mutants and thorough validation of both the genotype and phenotype .

What experimental approaches can reveal potential in vivo substrates of Sll0528?

Identifying the in vivo substrates of Sll0528 requires sophisticated experimental approaches. While the search results don't explicitly discuss methods for substrate identification, based on current protease research methods, several approaches could be employed:

  • Comparative proteomics:

    • Compare the membrane proteome of wild type and sll0528 knockout mutants under stress conditions

    • Identify proteins that accumulate in the knockout, suggesting they are potential substrates

    • Use techniques such as 2D-DIGE (Differential Gel Electrophoresis) or quantitative mass spectrometry

  • Substrate-trapping approaches:

    • Generate catalytically inactive Sll0528 mutants that can bind but not cleave substrates

    • Express these mutants in Synechocystis and isolate protein complexes

    • Identify trapped substrates using mass spectrometry

  • Proximity-based labeling:

    • Fuse Sll0528 with a proximity-labeling enzyme (BioID or APEX2)

    • Express the fusion protein in Synechocystis

    • Identify proteins in close proximity to Sll0528 that may be potential substrates

  • N-terminomics:

    • Use techniques like TAILS (Terminal Amine Isotopic Labeling of Substrates) to identify protein N-termini generated by protease activity

    • Compare N-terminomes of wild type and sll0528 knockout under stress conditions

  • Candidate approach:

    • Focus on membrane-bound transcription factors or stress-related proteins known to be regulated by proteolysis

    • Test direct interactions between Sll0528 and candidate substrates

    • Validate cleavage of candidates in vitro using recombinant Sll0528

Since the in vivo substrates of Sll0528 remain unknown, these approaches would provide valuable insights into the molecular mechanisms by which this metalloprotease mediates stress responses in Synechocystis .

How do different stress conditions influence Sll0528 activity and substrate specificity?

While the gene expression of sll0528 under different stress conditions has been well-characterized, the influence of these stresses on Sll0528 protein activity and substrate specificity represents an important research frontier. Future investigations might explore:

  • Stress-specific activation mechanisms:

    • Different stressors (salt, cold, hyperosmotic) may trigger distinct post-translational modifications of Sll0528

    • Membrane physical changes (like rigidification during cold stress) might directly affect Sll0528 conformation and activity

    • The protein may associate with different cofactors under various stress conditions

  • Substrate repertoire variations:

    • Different stressors may expose distinct substrate cleavage sites through conformational changes

    • The localization or abundance of substrates may vary under different stress conditions

    • Stress-specific accessory proteins may recruit different substrates to Sll0528

  • Integration with stress-specific signaling networks:

    • Cold, salt, and hyperosmotic stress responses involve both overlapping and distinct signaling pathways

    • Sll0528 may interact differently with components of these pathways under various stresses

    • The timing of Sll0528 activation relative to other stress response mechanisms may vary

Research approaches to address these questions could include:

  • In vitro activity assays under conditions mimicking different stresses

  • Identifying differential protein interactions of Sll0528 under various stress conditions

  • Structural studies of Sll0528 under different conditions to observe conformational changes

  • Time-course analyses of proteolytic events following different stressors

Understanding these aspects would provide deeper insights into how a single protease can mediate responses to multiple distinct stressors.

What are the regulatory mechanisms controlling sll0528 expression and activity?

The remarkable stress-induced upregulation of sll0528 suggests sophisticated regulatory mechanisms. While the search results provide data on expression patterns, further research into regulatory mechanisms could explore:

  • Transcriptional regulation:

    • Identification of promoter elements responsible for stress-induced expression

    • Characterization of transcription factors binding to the sll0528 promoter

    • Investigation of the role of RNA polymerase sigma factors in stress-specific induction

    • Epigenetic mechanisms potentially contributing to expression control

  • Post-transcriptional regulation:

    • Analysis of mRNA stability and degradation rates under different conditions

    • Potential role of small non-coding RNAs in regulating sll0528 expression

    • Investigation of translational control mechanisms

  • Post-translational regulation and enzyme activation:

    • Required proteolytic processing for activation (as common in many proteases)

    • Role of membrane lipid composition in modulating activity

    • Potential cofactor requirements or inhibitory molecules

    • Regulation through subcellular localization or compartmentalization

  • Integration with known stress signaling pathways:

    • Connection to two-component systems known to sense salt, cold, and osmotic stress

    • Relationship to other stress-responsive metalloproteases

    • Role in feedback regulation of stress response pathways

Understanding these regulatory layers would provide crucial insights into how Sll0528 functions within the broader stress response network of Synechocystis and potentially reveal new principles of stress-responsive gene regulation in cyanobacteria.

How can understanding Sll0528 contribute to improving cyanobacterial stress tolerance?

Understanding the function and mechanisms of Sll0528 has significant implications for improving stress tolerance in cyanobacteria, with potential applications in biotechnology and agriculture:

  • Genetic engineering approaches:

    • Controlled overexpression of sll0528 might enhance tolerance to salt, cold, and hyperosmotic stress

    • Introduction of modified versions of sll0528 with enhanced activity or altered regulation could create strains with superior stress resistance

    • Expression of sll0528 in other cyanobacterial species might improve their stress tolerance

  • Identification of stress response networks:

    • Mapping the substrates and signaling pathways connected to Sll0528 would reveal critical stress response mechanisms

    • This knowledge could identify multiple targets for enhancing stress tolerance

    • Understanding the integration of Sll0528 with other stress response systems would allow for more sophisticated engineering approaches

  • Biotechnological applications:

    • Development of biosensors based on sll0528 expression for detecting environmental stressors

    • Creation of cyanobacterial strains with enhanced tolerance for bioproduction applications in challenging environments

    • Potential use in phytoremediation applications in high-salt environments

  • Fundamental insights into stress biology:

    • S2Ps are conserved across diverse organisms including plants

    • Principles learned from Sll0528 might be applicable to improving stress tolerance in crops

    • Understanding proteolytic regulation of stress responses could reveal new paradigms in cellular adaptation

The critical role of Sll0528 in multiple stress responses makes it a valuable target for both fundamental research and applied biotechnology aimed at developing more resilient cyanobacterial strains for various applications .

What evolutionary insights can be gained from studying cyanobacterial S2Ps like Sll0528?

Studying Sll0528 and other cyanobacterial S2Ps offers valuable evolutionary insights:

  • Conservation across cyanobacterial lineages:

    • S2P homologs are universally present in all available cyanobacterial genomes, including those with reduced genomes like marine Synechococcus and Prochlorococcus

    • This universal conservation suggests fundamental and essential functions that have been maintained throughout cyanobacterial evolution

  • Specialization of S2P functions:

    • The presence of multiple S2Ps in Synechocystis (Sll0528, Slr0643, Sll0862, and Slr1821) with different expression patterns suggests functional diversification

    • The specific strong induction of sll0528 under stress conditions indicates evolutionary specialization for stress response roles

  • Connections to eukaryotic stress responses:

    • S2Ps are found across diverse domains of life

    • Studying cyanobacterial S2Ps may provide insights into the evolution of stress response mechanisms in photosynthetic organisms

    • Potential evolutionary relationships between cyanobacterial S2Ps and chloroplast stress response systems in plants

  • Adaptation to different ecological niches:

    • Comparative analysis of S2Ps across cyanobacteria living in different environments could reveal adaptations to specific ecological challenges

    • The role of S2Ps in stress tolerance likely contributed to the ability of cyanobacteria to colonize diverse habitats

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.