Recombinant Synechocystis sp. Putative zinc metalloprotease slr1821 (slr1821)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Synechocystis sp. Putative zinc metalloprotease slr1821, also referred to as slr1821, is a protein identified in the cyanobacterium Synechocystis sp. PCC 6803 . It is a Site-2 Protease (S2P) homolog, which are intramembrane-cleaving proteases that usually contain a zinc metalloprotease domain . Slr1821 is involved in various cellular processes, most notably in the acclimation to ammonium stress .

Role in Ammonium Stress Acclimation

Excess ammonium can be toxic to cyanobacteria, and Synechocystis sp. PCC 6803 has developed mechanisms to acclimate to such stress . Slr1821 is an essential regulator in this process . A knockout mutant of slr1821 showed a significantly retarded growth upon exposure to high concentrations of ammonium sulfate, indicating that the protein is crucial for acclimation to high ammonium levels .

Slr1821 influences the expression of genes related to nitrogen and carbon assimilation . In response to ammonium stress, Synechocystis 6803 suppresses nitrogen uptake and assimilation, ammonium integration, and mobilization of other nitrogen sources . This coordinated regulation, which maintains carbon/nitrogen homeostasis, relies on functional Slr1821 .

Impact on Gene Expression

Transcriptomic analysis of the slr1821 knockout mutant revealed that the proper expression of a significant portion of ammonium-responsive genes is Slr1821-dependent . Specifically, approximately 60% of the ammonium-activated genes and 67% of the ammonium-repressed genes require Slr1821 for their appropriate regulation . Without functional Slr1821, the expression of these genes is either abolished or reversed, highlighting the protein's regulatory role in the ammonium stress response .

Involvement in EPS Production

Synechocystis PCC6803 produces extracellular polysaccharides (EPS), which protect against environmental stresses such as salt, metal exposure, and iron starvation . While slr1821 itself is not directly categorized as an EPS production gene, other genes with sequence homology to EPS production genes (e.g., exoD, gumB, and gumC) have been studied in relation to EPS production in Synechocystis . These genes (sll0923, sll1581, and slr1875) play a role in EPS production, influencing the synthesis of both cell-attached EPS (CPS) and released EPS (RPS) .

Zinc Regulation

The regulation of zinc levels is crucial for cellular function, and Synechocystis PCC 6803 employs various mechanisms to maintain zinc homeostasis . The ziaA gene, which encodes a heavy metal transporting P-type ATPase, contributes to zinc tolerance . The expression of ziaA is regulated by the repressor protein ZiaR, which responds to zinc levels . Although slr1821 is a zinc metalloprotease, its direct involvement in the regulation of ziaA or ZiaR has not been established .

Tables of Data

Due to the constraints, I cannot create tables.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if different. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its use in production.
Synonyms
slr1821; Putative zinc metalloprotease slr1821
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-366
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
slr1821
Target Protein Sequence
MSVLAALAAIGVLAVLIAVHELGHFAAARLQGIHVTRFALGFGPPLLKYQGAETEYSIRA IPLGGYVAFPDDDPDSEIPADDPNLLKNRPILDRAIVISAGVIANLVFAYFLLIGQVSTI GFQNIQPGLVIPQVDSASAAQVAGMEPGDIVLSLQGNTLPGFPDATTQFIDIVRRSPSVP ITVEVQRGEETKTLTITPTPDAEGKGKIGVALLPNVETKRASNPLEALTYSAEAFERIVK LTTQGFWQLISNFADNASQVAGPVKIVEYGANIARSDASNLFQFGALISINLAVINILPL PALDGGQLVFLLIEGLLGKPLPEKFQMGVMQTGLVLLLSLGVFLIVRDTLNLTFVQEFLP SFTGYE
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M50B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Slr1821 and what is its primary function in Synechocystis sp. PCC 6803?

Slr1821 is a putative zinc metalloprotease belonging to the Site-2-Protease (S2P) family found in the cyanobacterium Synechocystis sp. PCC 6803. S2Ps mediate proteolysis of transmembrane transcriptional regulators, a conserved mechanism for regulating transmembrane signaling .

Functionally, Slr1821 has been identified as an essential regulator of carbon/nitrogen homeostasis, particularly during ammonium stress. Recent transcriptomic analysis of knockout mutants has demonstrated that Slr1821 is indispensable for proper expression of approximately 60% of NH4+ activated genes and 67% of NH4+ repressed genes . This indicates its crucial role in coordinating metabolic responses to fluctuating nutrient conditions.

How should recombinant Slr1821 be optimally stored and handled in a laboratory setting?

For optimal stability and activity maintenance, recombinant Slr1821 should be stored using the following protocol:

Storage ConditionRecommendation
Short-term storage4°C for up to one week
Long-term storage-20°C or -80°C
Buffer compositionTris-based buffer with 50% glycerol, optimized for protein stability
Important notesRepeated freezing and thawing is not recommended

The shelf life is typically 6 months for liquid formulations at -20°C/-80°C and 12 months for lyophilized formulations at the same temperatures . These storage conditions help maintain the structural integrity and enzymatic activity of the protein for experimental applications.

What expression systems are most effective for producing recombinant Slr1821?

The most commonly used and effective expression system for recombinant Slr1821 is an in vitro Escherichia coli expression system . When expressing Slr1821, researchers typically use one of two tagging approaches:

  • N-terminal 10xHis-tag: This approach facilitates purification using nickel affinity chromatography and is documented in commercial preparations .

  • GST-fusion tag: A GST-Slr1821 construct has been successfully used to demonstrate proteolytic activity against beta-casein . This system allows for protein purification using glutathione affinity chromatography.

The choice between these systems depends on downstream applications, with the His-tagged version being more compact and the GST-fusion providing additional solubility benefits for certain applications.

How can the proteolytic activity of Slr1821 be reliably measured in vitro?

The proteolytic activity of Slr1821 can be assayed using beta-casein as a substrate through the following methodology:

  • Preparation of recombinant enzyme:

    • Express GST-Slr1821 in E. coli

    • Purify using glutathione affinity chromatography

    • Verify purity by SDS-PAGE

  • Activity assay procedure:

    • Incubate purified Slr1821 with beta-casein in appropriate buffer

    • Monitor time-dependent proteolytic cleavage

    • Analyze digestion products by SDS-PAGE to visualize fragment patterns

  • Controls and verification:

    • Include negative controls (unrelated GST-tagged protein)

    • Test inhibitor specificity (o-phenanthroline inhibits activity, while EDTA-free protease inhibitor cocktails do not)

This time-dependent cleavage of beta-casein into smaller fragments confirms the metalloprotease activity of Slr1821. The inhibition by metal chelators but not by serine/cysteine protease inhibitors further validates its classification as a metalloprotease .

What experimental design approaches are most appropriate for studying Slr1821 function in vivo?

Based on published research, the most effective experimental designs for studying Slr1821 function involve:

  • Knockout mutant generation and characterization:

    • Create a complete knockout of the slr1821 gene using homologous recombination with antibiotic resistance markers (typically chloramphenicol or kanamycin)

    • Verify complete segregation through PCR and sequencing

    • Confirm absence of slr1821 transcripts using RT-PCR

    • Compare growth, pigmentation, and stress responses to wild-type under various conditions

  • Gene expression profiling under various stress conditions:

    • Employ RT-qPCR to measure temporal expression patterns in response to:

      • Salt stress (854 mM NaCl)

      • Cold stress (18°C)

      • Hyperosmotic stress (0.5 M sorbitol)

      • High light (200 μmol·photons·m^-2·s^-1)

      • Mixotrophic growth (2.5 mM glucose)

    • Track expression at multiple time points (0.25h, 0.5h, 1h, 2h, 4h, 6h) to capture dynamics

  • RNA-seq transcriptomic analysis:

    • Compare wild-type and knockout mutants under normal and stress conditions

    • Analyze differential gene expression to identify Slr1821-dependent pathways

    • Use ~15-24 million reads per sample to achieve >98.7% coverage

These approaches have successfully demonstrated Slr1821's role in stress responses and provide a methodological framework for further functional studies .

How does Slr1821 compare functionally to other Site-2-Proteases in Synechocystis sp. PCC 6803?

Synechocystis sp. PCC 6803 contains four Site-2-Proteases (S2Ps): Sll0528, Slr0643, Sll0862, and Slr1821. Comparative functional analysis reveals distinct roles:

S2PPrimary FunctionStress Response ProfileGene Induction Level
Sll0528Salt, cold, and hyperosmotic stress acclimationStrongly induced by salt, cold, and hyperosmotic stress>50-fold at 4-6h (salt), >100-fold (cold)
Slr0643Limited role in stress responseMild induction under salt stress<3-fold at 0.5h
Sll0862Limited role in stress responseMild induction under salt stress<3-fold at 0.5h
Slr1821Carbon/nitrogen homeostasis regulationCritical for ammonium stress responseStrongly induced under NH4+ stress

Slr1821 is particularly distinguished by its essential role in regulating carbon/nitrogen balance during ammonium stress, while Sll0528 shows the strongest responses to abiotic stresses like salt and cold . This functional differentiation suggests evolutionary specialization of these proteases for different cellular stress responses.

What phenotypic effects are observed in slr1821 knockout mutants under different stress conditions?

Knockout mutants of slr1821 display distinct phenotypes under specific stress conditions:

  • Under normal growth conditions:

    • Similar phenotype to wild-type

    • Normal phototrophic growth rates

    • No observable differences in pigmentation or photosystems

  • Under ammonium stress (15 mM (NH4)2SO4):

    • Significantly retarded growth compared to wild-type

    • Compromised acclimation to NH4+ toxicity

    • Defective photosynthesis

    • Disrupted proper response of regulators and transporters in the ammonium-specific stimulon

    • Compromised translational and transcriptional machinery

  • Response to other stresses:

    • Normal phenotype under high light, mixotrophic growth, salt or ethanol stress

    • Unlike Sll0528 mutants, which show increased sensitivity to salt, cold, and hyperosmotic stress

This selective sensitivity to ammonium stress but not other stresses provides strong evidence for Slr1821's specialized role in nitrogen metabolism regulation .

How does Slr1821 regulate carbon/nitrogen homeostasis at the molecular level?

Slr1821 regulates carbon/nitrogen homeostasis through coordination of multiple pathways, as revealed by transcriptomic analysis:

  • Nitrogen metabolism regulation:

    • Suppresses nitrogen uptake and assimilation under NH4+ stress

    • Controls ammonium integration and mobilization of other nitrogen sources

    • Regulates repression of nitrogen regulatory protein PII and PII interactive protein PirC

    • Coordinates expression of transporters in the ammonium-specific stimulon

  • Carbon metabolism coordination:

    • Activates carbon acquisition regulator RcbR under increasing nitrogen conditions

    • Maintains carbon/nitrogen balance through reciprocal regulation of assimilation pathways

    • Prevents metabolic imbalances that would lead to growth inhibition

  • Molecular mechanism:

    • As a Site-2-Protease, Slr1821 likely cleaves membrane-bound transcription factors

    • This proteolysis likely activates or deactivates specific transcriptional regulators

    • The released transcription factor fragments then mediate appropriate gene expression changes

The coordinated regulation of carbon and nitrogen metabolism mediated by Slr1821 represents an adaptation mechanism to maintain nutrient homeostasis under fluctuating environmental conditions .

What are the best experimental designs for studying substrate specificity and cleavage sites of Slr1821?

To effectively study substrate specificity and identify cleavage sites of Slr1821, researchers should consider the following experimental approaches:

  • In vitro proteolytic assays with candidate substrates:

    • Incubate purified Slr1821 with potential substrates (transmembrane transcription factors)

    • Analyze cleavage products using SDS-PAGE and western blotting

    • Compare with site-directed mutants lacking catalytic activity as controls

    • The beta-casein assay provides a useful starting point for optimizing conditions

  • N-terminal sequencing of cleavage products:

    • Separate proteolytic fragments using RP-HPLC

    • Perform Edman degradation or mass spectrometry to determine cleavage sites

    • Compare identified sites to establish consensus sequences

  • Single-case experimental design (SCED) approaches:

    • These provide a flexible alternative to group designs with large sample sizes

    • Implement repeated, systematic assessment of variables over time

    • Establish representative baseline phases for comparison with subsequent phases

    • Ensure sufficient data points in each phase (minimum 3-5 points recommended)

    • Consider adding randomization components to improve methodological rigor

  • Substrate library screening:

    • Generate peptide libraries representing potential cleavage sites

    • Use fluorescence resonance energy transfer (FRET) peptides for high-throughput screening

    • Identify motifs preferentially cleaved by Slr1821

These approaches should be complemented with appropriate controls and statistical analyses to ensure reliable characterization of Slr1821's enzymatic properties and substrate preferences.

How can time-lagged correlation analysis be applied to study Slr1821's role in gene regulatory networks?

Time-lagged correlation analysis represents a powerful approach for elucidating Slr1821's position within gene regulatory networks:

  • Experimental design considerations:

    • Conduct time-series experiments exposing Synechocystis to serial stress perturbations

    • Monitor gene expression using whole-genome DNA microarrays at 20-minute intervals

    • Extend sampling over 8-16 hour periods to capture regulatory dynamics

    • Include both wild-type and slr1821 knockout strains

  • Analytical approach:

    • Construct correlations between time-shifted transcription profiles

    • Assign different levels of statistical confidence to identified correlations

    • Infer putative cause-effect relationships among genes

    • Compare regulatory networks between wild-type and slr1821 knockout strains

  • Critical design parameters:

    • Frequency of sampling: 20-minute intervals have proven effective for detecting regulatory relationships

    • Duration of experiment: extend long enough to capture complete stress response cycles

    • Statistical validation: use appropriate statistical methods to verify significance of correlations

This approach has successfully identified regulatory networks in Synechocystis sp. under light transitions and could reveal how Slr1821 influences gene expression dynamics during ammonium stress response .

What interactions exist between Slr1821 and zinc regulation pathways in Synechocystis?

As a putative zinc metalloprotease, Slr1821 may interact with zinc regulatory pathways in Synechocystis through several mechanisms:

  • Potential relationship with zinc-responsive transcription factors:

    • ZiaR (product of sll0792) is a known Zn²⁺-responsive repressor in Synechocystis

    • ZiaR regulates transcription of ziaA (slr0798), a zinc-transporting P-type ATPase

    • Disruption of ziaA results in reduced Zn²⁺ tolerance

    • Slr1821 may process membrane-bound transcription factors involved in this or parallel zinc regulatory pathways

  • Zinc-dependent activity:

    • As a zinc metalloprotease, Slr1821's activity likely depends on zinc availability

    • Under zinc limitation, its proteolytic function may be compromised

    • This could establish a feedback loop between zinc homeostasis and ammonium stress response

  • Investigational approaches:

    • Compare transcriptomes of slr1821 knockout mutants under normal and zinc-limited conditions

    • Examine expression patterns of zinc transporters and regulators in wild-type versus slr1821 mutants

    • Measure intracellular zinc concentrations in wild-type and mutant strains under ammonium stress

    • Test whether zinc supplementation can rescue phenotypes of slr1821 mutants

Understanding these potential interactions could reveal important cross-talk between metal homeostasis and nitrogen metabolism in cyanobacteria.

What approaches could identify the in vivo substrates of Slr1821?

Identifying the physiological substrates of Slr1821 represents a critical research gap. The following integrated approaches would be most effective:

  • Comparative proteomics:

    • Compare membrane protein profiles between wild-type and slr1821 knockout strains

    • Use stable isotope labeling with amino acids in cell culture (SILAC) for quantitative analysis

    • Focus on proteins that accumulate in the mutant, suggesting they may be Slr1821 substrates

    • Validate candidates through in vitro cleavage assays

  • Proximity labeling techniques:

    • Express Slr1821 fused to biotin ligase (BioID) or peroxidase (APEX)

    • Allow proximity-dependent labeling of interacting proteins

    • Purify and identify labeled proteins by mass spectrometry

    • Filter candidates based on transmembrane localization and regulatory functions

  • Catalytically inactive mutant approach:

    • Generate catalytically inactive Slr1821 through site-directed mutagenesis

    • This mutant should trap substrates by binding but not cleaving them

    • Immunoprecipitate the inactive Slr1821 and identify bound proteins

    • Verify with in vitro cleavage assays using wild-type enzyme

These complementary approaches would provide multiple lines of evidence toward identifying the authentic physiological substrates of Slr1821, greatly advancing our understanding of its role in stress response mechanisms.

How could Slr1821 research contribute to bioengineering applications in cyanobacteria?

Understanding Slr1821's role in carbon/nitrogen homeostasis opens several promising bioengineering applications:

  • Bioremediation of high-ammonium wastewater:

    • Overexpression of slr1821 could potentially enhance ammonium tolerance

    • Engineered Synechocystis strains could be used for treating ammonium-rich wastewaters

    • Combination with downstream carbon fixation pathways could convert waste nutrients into valuable biomass

  • Improved photosynthetic efficiency:

    • Optimizing Slr1821 activity could enhance carbon/nitrogen balance

    • This could redirect metabolic flux toward desired products under nitrogen-sufficient conditions

    • Target applications include biofuel production and carbon sequestration

  • Stress-tolerant crop development:

    • Knowledge of Slr1821 mechanisms could inform engineering of ammonium tolerance in crop plants

    • Transgenic expression of modified S2Ps in plants might enhance nitrogen use efficiency

    • This approach could reduce fertilizer requirements and environmental impacts

  • Biosensor development:

    • Promoter regions responsive to Slr1821-regulated pathways could be coupled to reporter genes

    • Such biosensors could monitor nitrogen status in various environments

    • Applications include environmental monitoring and optimizing bioproduction processes

These applications highlight the potential translational impact of fundamental research on Slr1821 and related stress-response regulators in photosynthetic organisms.

What are the most common challenges in generating completely segregated slr1821 knockout mutants?

Generating completely segregated slr1821 knockout mutants can present several challenges:

  • Ensuring complete segregation:

    • Cyanobacteria contain multiple genome copies, requiring complete replacement in all copies

    • Solutions:

      • Multiple rounds of selection on increasing antibiotic concentrations

      • Single-colony isolation after each selection round

      • PCR verification with primers flanking the insertion site (as shown with primers P7 and P8 in published protocols)

      • Confirmation by RT-PCR to verify absence of transcripts

  • Potential lethality or severe growth defects:

    • If the knockout severely impairs growth, obtaining completely segregated mutants may be difficult

    • Solutions:

      • Use glucose-supplemented medium during initial selection if mixotrophic growth is less affected

      • Consider conditional knockouts or partial knockdowns as alternatives

      • Verify viability under all experimental conditions before proceeding

  • Clone verification:

    • Ensuring correct insertion without secondary mutations

    • Solutions:

      • Use Thermal Asymmetric Interlaced PCR (TAIL-PCR) to verify flanking regions

      • Sequence PCR products to confirm precise insertion sites

      • Check for spontaneous suppressor mutations that might arise during selection

Following established protocols that have successfully generated completely segregated slr1821 mutants will maximize chances of success .

How can researchers overcome challenges in measuring Slr1821 protease activity in vitro?

Measuring proteolytic activity of metalloproteases like Slr1821 presents several technical challenges. Here are effective solutions:

  • Protein solubility and activity issues:

    • Challenge: Transmembrane proteins often have solubility problems

    • Solutions:

      • Use detergent-based extraction methods optimized for membrane proteins

      • Consider fusion tags that enhance solubility (GST has proven effective)

      • Optimize buffer conditions with glycerol to maintain native conformation

      • Test activity immediately after purification to minimize activity loss

  • Assay sensitivity and specificity:

    • Challenge: Distinguishing Slr1821 activity from contaminating proteases

    • Solutions:

      • Include negative controls (GST-only or unrelated protein preparations)

      • Use specific inhibitor profiles (o-phenanthroline inhibits metalloproteases)

      • Perform time-course experiments to verify progressive substrate cleavage

      • Use highly purified protein preparations with size-exclusion chromatography step

  • Detecting cleavage products:

    • Challenge: Visualizing and quantifying proteolytic fragments

    • Solutions:

      • Use fluorogenic substrates for quantitative measurements

      • Employ SDS-PAGE with sensitive protein staining for qualitative assessment

      • Consider western blotting if antibodies to substrate are available

      • Use mass spectrometry for precise identification of cleavage products and sites

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.