Recombinant Synechocystis sp. Sulfate transport system permease protein CysW (cysW)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

Recombinant Synechocystis sp. Sulfate Transport System Permease Protein CysW (cysW) is a transmembrane component of the ATP-binding cassette (ABC) transporter responsible for sulfate uptake. This protein is encoded by the cysW gene and functions alongside CysT and CysA to form a high-affinity sulfate/thiosulfate transporter . The recombinant variant is heterologously expressed in hosts such as E. coli, yeast, or mammalian cells, achieving ≥85% purity as confirmed by SDS-PAGE .

Genomic Context and Operon Structure

In Synechocystis sp. PCC 6803, cysW is part of a conserved operon (sbpA-ssr2439-cysT-cysW-cysA) that coordinates sulfate transport . This operon structure contrasts with proteobacterial systems (e.g., E. coli’s cysPTWAM operon), which are regulated by the CysB transcription factor. Synechocystis lacks CysB homologs, suggesting divergent regulatory mechanisms .

GeneProductFunction
sbpASulfate-binding proteinSubstrate recognition and binding
cysTPermease subunitTransmembrane sulfate translocation
cysWPermease subunitPartner to CysT in membrane transport
cysAATP-binding subunitEnergy hydrolysis for transport

Functional Role in Sulfate Transport

CysW is critical for sulfate acquisition, particularly under sulfur-limited conditions. In marine cyanobacteria like Synechococcus sp. PCC 7002, the ABC transporter (including cysW) is upregulated during sulfur deprivation, replacing low-affinity sulfate permeases to maintain cellular sulfur homeostasis . This adaptation highlights the protein’s role in high-affinity transport systems essential for survival in fluctuating environments .

Recombinant Production and Purification

Recombinant CysW is commercially available with the following specifications :

  • Host Systems: E. coli, yeast, baculovirus, or mammalian cells.

  • Purity: ≥85% (SDS-PAGE verified).

  • Tagging: Often fused with N-terminal His tags for affinity chromatography.

  • Applications: Antibody production, enzymatic assays, and structural studies.

Transcriptional Regulation

While proteobacterial cys operons are regulated by CysB, Synechocystis lacks this regulator. Instead, a conserved TAAWATGATT motif upstream of cysT and cysA suggests alternative regulatory mechanisms, potentially involving redox or nutrient-sensing pathways .

Sulfur Limitation Responses

Under sulfur-deprived conditions, Synechococcus sp. PCC 7002 upregulates cysW 14–24-fold, indicating its prioritization in sulfate scavenging . This response is absent in nutrient-replete environments, where low-affinity transporters dominate .

Applications in Biotechnology and Research

  • Metabolic Engineering: Enhancing sulfate uptake in cyanobacterial chassis for biofuel or bioplastic production.

  • Stress Response Studies: Investigating sulfur metabolism under environmental stressors (e.g., salinity, heavy metals) .

  • Structural Biology: Resolving ABC transporter mechanisms via recombinant CysW for cryo-EM or X-ray crystallography .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
cysW; slr1454; Sulfate transport system permease protein CysW
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
cysW
Target Protein Sequence
MLTINLPKTFKVKYLLIALALFYLILVLLLPAIAVFYEAFHKGVEPFIQAMGDRNFQSAL QLTVVMALISVPLNTVFGLCAAWVLARNQFPGRALFLSVLDLPFSISPVVAGLMIVLLYG KNGWIGSWFASWDIQIIFSVPGMAIATIFVTLPFVAREVIPVLEELGPEQEEAARTLGAK DWQIFWRVTLPNIRWGLLYGVLLTNARAMGEFGAVAVVSGSILGKTSTLPIFVEQEYKNY QTEAAFGAAVVLALLAVVTLVLKEILEQRTGHHKAV
Uniprot No.

Target Background

Function
CysW is a component of the ABC transporter complex CysAWTP (TC 3.A.1.6.1), involved in sulfate/thiosulfate import. It is likely responsible for substrate translocation across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of CysW in bacterial sulfate transport systems?

CysW functions as a critical permease component of the SulT family of transporters (TCDB 3.A.1.6) that couple sulfate transport with ATP hydrolysis. In bacterial systems, CysW interacts with the periplasmic sulfate binding protein (Sbp), another permease component CysT, and the ATP-binding subunit CysA to form a complete transport complex. This integrated system enables selective sulfate uptake from the environment for metabolic processes . Based on research in other bacterial systems, CysW likely forms part of the transmembrane channel through which sulfate ions are translocated across the cell membrane.

How is the cysW gene organized in bacterial genomes and what is its evolutionary significance?

The sulfate permease components are typically encoded as an operon by the cysPTWA genes, although the sulfate binding protein gene (sbp) is often located separately on the genome . This genomic organization reflects the functional coupling of these components in the transport process. Evolutionary analysis suggests that the core architecture of these transporters is conserved across diverse bacterial species, with islands of strong sequence similarity throughout cyanobacterial and plant systems, indicating conserved functional domains . Researchers investigating Synechocystis sp. should examine both the operon structure and any potential adaptations specific to this cyanobacterium.

What structural characteristics define CysW and how do they relate to its function?

While specific structural data for Synechocystis CysW is not explicitly detailed in the search results, insights from related transport proteins suggest a characteristic membrane protein topology with multiple transmembrane domains. As demonstrated in the structural studies of related transporters like YeeE, which has been crystallized at 2.5-Å resolution, these proteins often contain conserved residues essential for transport activity . Studies with other recombinant Synechocystis proteins have shown they can form dimers in vitro, which may be relevant for CysW oligomerization and function .

What expression systems are optimal for producing functional recombinant Synechocystis CysW?

Based on experience with other Synechocystis proteins, Escherichia coli provides an effective heterologous expression system. For instance, the complete sequence of the Synechocystis chromosome revealed a phytochrome-like sequence that yielded an authentic phytochrome when overexpressed in E. coli . For membrane proteins like CysW, considerations include:

  • Vector selection with appropriate promoters (e.g., T7 or arabinose-inducible systems)

  • E. coli strains optimized for membrane protein expression (such as C41/C43(DE3) derivatives)

  • Growth temperature optimization (typically 18-30°C for membrane proteins)

  • Induction conditions (IPTG concentration and induction time)

The recombinant protein can be purified using affinity chromatography if tagged appropriately, with attention to detergent selection for membrane extraction .

What structural and functional assays can effectively characterize recombinant CysW?

Multiple complementary approaches should be employed:

Assay TypeMethodologyInformation Obtained
Structural AnalysisSize-exclusion chromatographyNative molecular weight, oligomerization state
Circular dichroismSecondary structure content
X-ray crystallographyAtomic resolution structure (as achieved with YeeE at 2.5-Å)
Functional AnalysisGrowth complementation assaysIn vivo function (e.g., ΔcysPUWA strains)
Radioisotope uptake measurementsTransport kinetics (Km, Vmax)
Site-directed mutagenesisIdentification of essential residues

For structural studies, membrane proteins often require stabilization in detergent micelles or reconstitution into nanodiscs or liposomes. Size-exclusion chromatography has been successfully used with other Synechocystis proteins, showing they elute predominantly as specific molecular weight species (e.g., 115-kDa and 170-kDa for phytochrome) .

How can molecular dynamics simulations enhance our understanding of CysW transport mechanisms?

Molecular dynamics (MD) simulations provide valuable insights into the dynamics of membrane transport proteins. Based on approaches used for the YeeE protein, a comprehensive MD protocol for CysW would include:

  • Preparation of a structural model based on crystallographic data or homology modeling

  • Embedding the protein into a phospholipid bilayer (e.g., POPC)

  • System solvation with appropriate water model (e.g., TIP3P) and physiological ion concentrations

  • Energy minimization followed by equilibration in NVT and NPT ensembles

  • Production simulations of 100+ ns to observe conformational changes

Analysis should focus on:

  • Substrate binding site interactions

  • Conformational changes during transport cycle

  • Role of conserved residues in substrate coordination

  • Water and ion movements through the transport channel

The Charmm36 force field has been successfully applied to similar systems, with interactions analyzed using tools such as jsPISA .

How do mutations in conserved residues affect CysW function and what does this reveal about the transport mechanism?

Growth complementation assays using knockout strains have proven effective for analyzing the functional impact of mutations. For example, in the related YeeE protein, three highly conserved cysteine residues (C22, C91, and C293) are essential for transport activity . A methodological approach for CysW would involve:

  • Identification of conserved residues through sequence alignment

  • Site-directed mutagenesis of these residues

  • Expression in a ΔcysPUWA strain lacking endogenous sulfate transport

  • Assessment of growth under sulfate-limited conditions

  • Measurement of sulfate uptake rates in complemented strains

Special attention should be paid to residues in the membrane-spanning regions that might form the transport channel, as these often show characteristic indentations that reduce the effective membrane thickness to approximately 15 Å in transport proteins .

What are the kinetic parameters of the Synechocystis sulfate transport system and how do they compare with other organisms?

While specific kinetic data for Synechocystis CysW is not provided in the search results, a comparative framework from other organisms provides context:

OrganismTransporterKm (μM)Characteristics
Salmonella typhimuriumSbp (SulT system)0.1Very high affinity
Mycobacterium tuberculosisSimilar protein36Moderate affinity
Escherichia coliCysZ0.72High affinity
Corynobacterium glutamicumCysZ>5000Low affinity; unable to grow with <5 mM sulfate

To determine kinetic parameters for Synechocystis CysW, researchers should:

  • Establish a radiolabeled sulfate uptake assay using purified protein in proteoliposomes or whole cells

  • Measure initial uptake rates at varying substrate concentrations

  • Plot data according to Michaelis-Menten kinetics to determine Km and Vmax

  • Analyze the effects of inhibitors, competitive substrates, and pH/temperature variations

How does thiosulfate transport compare with sulfate transport in Synechocystis, and what are the implications for metabolic engineering?

The energy efficiency of cysteine synthesis from thiosulfate is better than from sulfate due to fewer synthesis steps in the cytoplasm, making thiosulfate a more efficient sulfur source in organisms like E. coli and Saccharomyces cerevisiae . For Synechocystis research:

  • SulT permeases can transport both sulfate and thiosulfate, with the specificity determined by the periplasmic binding protein (Sbp for sulfate, CysP for thiosulfate)

  • Metabolic flux analysis should be conducted to compare the energetic efficiency of sulfate versus thiosulfate utilization

  • Gene expression studies can reveal whether the transport components are differentially regulated based on available sulfur sources

  • For metabolic engineering applications, optimization of thiosulfate uptake might provide an energetic advantage for recombinant protein production or bioprocessing applications

What computational approaches can predict substrate binding sites and transport pathways in CysW?

Advanced computational methods can provide valuable insights when experimental data is limited:

  • Homology modeling based on crystal structures of related transporters like YeeE (2.5-Å resolution)

  • Molecular docking simulations to identify potential substrate binding sites

  • Electrostatic surface mapping to identify positively charged pathways for anion transport

  • Conservation analysis to identify functionally important residues across homologs

  • Normal mode analysis to predict conformational changes associated with transport

These computational predictions should guide experimental design, particularly for site-directed mutagenesis and crosslinking studies to validate the transport pathway.

How can single-molecule techniques advance our understanding of CysW transport dynamics?

Single-molecule approaches offer unique insights into transporter function:

  • Fluorescence resonance energy transfer (FRET) to monitor conformational changes during transport cycles

  • Single-molecule force spectroscopy to measure substrate binding energetics

  • High-speed atomic force microscopy to visualize conformational dynamics in native-like membrane environments

  • Nanopore-based electrical recordings to capture individual transport events

These techniques require careful protein engineering to introduce fluorescent labels or attachment sites without disrupting function, but can reveal transport kinetics and mechanisms inaccessible to bulk measurements.

What is the relationship between CysW structure-function and the unique photosynthetic metabolism of Synechocystis sp.?

Synechocystis, as a photosynthetic organism, has unique metabolic requirements that may influence sulfate transport:

  • Investigate diurnal regulation of cysW expression and transport activity

  • Examine interactions between photosynthetic electron transport and sulfate reduction pathways

  • Compare sulfate transport kinetics under different light conditions

  • Analyze the integration of sulfate transport with cysteine biosynthesis for photosynthetic protein production

Research should consider how the energy requirements for sulfate transport are balanced with photosynthetic activity, potentially revealing unique regulatory mechanisms not present in non-photosynthetic bacteria.

What strategies can overcome common challenges in membrane protein purification from recombinant Synechocystis proteins?

Based on experience with other Synechocystis proteins, several approaches can address purification challenges:

  • Optimize solubilization conditions—recombinant Synechocystis proteins tend to form dimers in vitro and aggregate under low salt conditions

  • Screen multiple detergents; mild detergents like DDM or LMNG often preserve function

  • Consider fusion tags that enhance solubility (MBP, SUMO) in addition to affinity tags

  • Implement on-column detergent exchange during purification

  • Use size-exclusion chromatography as a final purification step to remove aggregates

The purity and solubility achieved with other recombinant Synechocystis gene products make them attractive models for molecular studies, including X-ray crystallography .

How can researchers distinguish between direct and indirect effects when analyzing CysW mutants?

When analyzing phenotypes of CysW mutants, several controls and complementary approaches should be implemented:

  • Complement with wild-type protein to confirm phenotype reversibility

  • Perform in vitro transport assays with purified protein to confirm direct effects on transport

  • Use microscopy with fluorescent protein fusions to confirm proper membrane localization of mutants

  • Combine multiple amino acid substitutions to identify synergistic effects or compensatory mutations

  • Perform comprehensive biophysical characterization (CD spectroscopy, thermal stability) to distinguish between folding defects and functional defects

These approaches help differentiate between mutations that directly affect transport mechanism versus those that impact protein stability or trafficking.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.