Recombinant Synechocystis sp. Thiol:disulfide interchange protein txlA homolog (txlA)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Synechocystis sp. Thiol:disulfide interchange protein txlA homolog (txlA) refers to a protein that is a homolog of the thiol:disulfide interchange protein TxlA found in the cyanobacterium Synechocystis sp. This recombinant protein is produced using genetic engineering techniques, often in E. coli, to facilitate research and application . The TxlA protein is involved in thiol-disulfide exchange reactions, which are crucial for maintaining protein structure and function, as well as redox regulation within the cell .

Synonyms: txlA; sll1980; Thiol:disulfide interchange protein TxlA homolog
UniProt ID: P73920

Role in Thiol-Disulfide Exchange

TxlA belongs to a class of proteins involved in thiol-disulfide exchange, which is essential for various cellular processes . These processes include protein folding, assembly, and redox regulation . Thiol-disulfide exchange is facilitated by enzymes like thioredoxins (TRXs) and protein disulfide isomerases (PDIs) . These proteins contain redox-active cysteine residues that catalyze the formation and breakage of disulfide bonds, thereby modulating protein structure and activity .

Applications and Research

The recombinant txlA protein is primarily used in biochemical assays and structural studies to understand its function in Synechocystis sp. . Specifically, the protein can be employed in SDS-PAGE analysis to verify its molecular weight and purity . Researchers use it to study the mechanisms of thiol-disulfide exchange in cyanobacteria and to identify its interacting partners .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
txlA; sll1980; Thiol:disulfide interchange protein TxlA homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
txlA
Target Protein Sequence
MTPAKIRNALLAVVAIALSAAVYLGFQTQTQGISLEAQAQRAIPLATALDNGRPTLVEFY ADWCTSCQAMAPDLAELKKNYGGSVNFAMLNVDNNKWLPEVLRYRVDGIPHFVYLDDTGT AIAESIGEQPLRVLEQNITALVAHEPIPYANVTGQTSVVENRTIEADPTSPRSHGNPRPS
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain proteins. It functions by transferring its disulfide bond to other proteins, undergoing reduction in the process.
Database Links
Protein Families
Thioredoxin family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the basic function of txlA in Synechocystis sp.?

The txlA protein (also known as sll1980) functions as a thiol:disulfide interchange protein in Synechocystis sp. (strain PCC 6803 / Kazusa). As the name suggests, it mediates the formation and rearrangement of disulfide bonds, playing a crucial role in protein folding and cellular redox homeostasis. This function is particularly important in photosynthetic organisms like Synechocystis, where redox regulation is essential for adapting to changing light conditions and environmental stresses .

How is the txlA gene organized in Synechocystis sp.?

The txlA gene is identified as sll1980 in the Synechocystis sp. PCC 6803 genome. While the complete genomic organization isn't detailed in the provided sources, research approaches typically involve analyzing the exon/intron structure through comparative genomic techniques similar to those used in other model organisms. Researchers should consider using genomic databases specific to cyanobacteria to identify regulatory elements and potential splice variants .

What expression systems are available for producing recombinant txlA protein?

Multiple expression systems have been developed for producing recombinant txlA protein, each with distinct advantages for different research applications:

  • E. coli expression systems (product code CSB-EP304181SSQ1)

  • Yeast expression systems (product code CSB-YP304181SSQ1)

  • Baculovirus expression systems (product code CSB-BP304181SSQ1)

  • Mammalian cell expression systems (product code CSB-MP304181SSQ1)

The choice of expression system should be guided by your specific research needs, including requirements for post-translational modifications, protein folding, and downstream applications .

What are the optimal reconstitution protocols for lyophilized txlA protein?

For optimal reconstitution of lyophilized txlA protein:

  • Briefly centrifuge the vial before opening to ensure all material is at the bottom

  • Reconstitute in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation)

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Store aliquots at -20°C/-80°C for long-term stability

This protocol maintains protein stability while minimizing aggregation and denaturation that could affect experimental outcomes .

How can researchers effectively evaluate the purity and activity of recombinant txlA protein?

To evaluate recombinant txlA protein:

For purity assessment:

  • SDS-PAGE analysis (expect >85% purity based on standard production)

  • Western blotting with specific antibodies against txlA or fusion tags

  • Size exclusion chromatography to detect aggregates or truncated forms

For activity assessment:

  • Thiol:disulfide exchange activity assays using model substrates

  • Circular dichroism spectroscopy to confirm proper folding

  • Functional complementation in txlA-deficient strains

Each method provides complementary information about protein quality before experimental use .

What are the considerations for using biotinylated forms of txlA in experimental setups?

When using biotinylated forms of txlA (such as CSB-EP304181SSQ1-B with Avi-tag biotinylation):

  • Understand the biotinylation method: This protein utilizes in vivo AviTag-BirA technology, where E. coli biotin ligase (BirA) specifically attaches biotin to the 15 amino acid AviTag peptide

  • Consider potential steric hindrances: The biotin modification may affect protein folding or active site accessibility

  • Design appropriate controls: Include non-biotinylated protein controls to distinguish tag effects from protein activity

  • Select compatible detection systems: Streptavidin-based detection systems are ideal for biotinylated proteins

  • Account for possible modifications to binding kinetics: Biotinylation may alter interaction parameters with binding partners

These considerations ensure accurate interpretation of experimental results using biotinylated txlA .

How might txlA be utilized within CRISPR activation systems in Synechocystis?

While the search results don't directly connect txlA to CRISPR systems, the research on CRISPR activation in Synechocystis provides a framework for potential applications:

  • Consider txlA as a potential target gene for upregulation using the dCas12a-SoxS fusion system developed for Synechocystis

  • Design gRNAs targeting the non-template strand approximately -100 to -200bp upstream of the txlA transcription start site

  • Utilize the rhamnose-inducible Prha promoter for controlled expression of the CRISPRa system

  • Remember that activation efficiency may be inversely correlated with baseline expression levels of txlA

  • Account for the potentially narrow dynamic range of transcriptional regulation in Synechocystis

This approach could enable precise temporal control of txlA expression for functional studies .

What experimental design would be appropriate for studying txlA function using CRISPR technology?

A comprehensive experimental design for studying txlA function using CRISPR technology would include:

  • Construction of vectors:

    • dCas12a-SoxS fusion under Prha control

    • Multiple gRNAs targeting different positions relative to txlA TSS

    • Controls with non-targeting gRNAs

  • Transformation and strain verification:

    • PCR confirmation of integration

    • Sequencing validation

    • Growth curve analysis for fitness effects

  • Expression analysis:

    • RT-qPCR for txlA mRNA levels under different induction conditions

    • Western blot for txlA protein levels

    • Proteomics to identify changes in the redox proteome

  • Phenotypic characterization:

    • Redox stress response assays

    • Photosynthetic efficiency measurements

    • Metabolomic analysis

  • Data integration:

    • Correlation of txlA levels with phenotypic changes

    • Network analysis of affected pathways

This design provides mechanistic insights while accounting for the flexible editing window observed in Synechocystis CRISPRa systems .

How can researchers address challenges in differentiating native versus recombinant txlA activity in Synechocystis studies?

Differentiating native versus recombinant txlA activity presents several challenges that can be addressed through methodological approaches:

  • Tag-based discrimination:

    • Use epitope-tagged recombinant txlA that can be specifically detected

    • Develop antibodies that distinguish between native and recombinant forms

  • Genetic approaches:

    • Create a txlA knockout strain before introducing recombinant variants

    • Use codon-optimized recombinant sequences that can be distinguished by RT-qPCR

  • Biochemical distinction:

    • Introduce specific amino acid substitutions that alter electrophoretic mobility

    • Employ selective inhibitors that affect native and recombinant forms differently

  • Spatiotemporal control:

    • Express recombinant txlA under inducible promoters with distinct timing profiles

    • Target recombinant txlA to specific subcellular compartments using targeting sequences

  • Systems biology analysis:

    • Use mathematical modeling to deconvolute overlapping activities

    • Employ stable isotope labeling to track newly synthesized protein

These approaches enable precise attribution of observed effects to native or recombinant forms .

What methodological considerations are important when comparing txlA function across different cyanobacterial species?

When comparing txlA function across cyanobacterial species, researchers should consider:

  • Phylogenetic analysis:

    • Construct robust phylogenetic trees of txlA homologs

    • Identify conserved domains and species-specific variations

  • Expression system standardization:

    • Use the same heterologous expression system for all homologs

    • Normalize protein quantities precisely across experiments

  • Environmental parameter control:

    • Maintain identical growth conditions when comparing species

    • Account for species-specific optimal growth parameters

  • Assay optimization:

    • Develop activity assays that function across pH and salt concentration ranges

    • Establish standard substrate concentrations appropriate for all species variants

  • Statistical analysis:

    • Apply mixed-effects models to account for species as a random effect

    • Use bootstrapping approaches for robust comparison of kinetic parameters

  • Structural considerations:

    • Compare protein structures through homology modeling

    • Identify critical residues through site-directed mutagenesis across species

These methodological considerations ensure valid cross-species functional comparisons .

What are common pitfalls in analyzing thiol:disulfide interchange activity data and how can they be avoided?

Common pitfalls in analyzing thiol:disulfide interchange activity data include:

  • Redox buffer interference:

    • Solution: Use precisely controlled redox buffers; include controls to account for buffer-dependent effects

    • Validation: Test multiple buffer systems to confirm consistent activity patterns

  • Oxygen sensitivity:

    • Solution: Perform experiments under controlled atmospheric conditions

    • Validation: Include oxygen-scavenging systems in reaction mixtures

  • pH-dependent kinetics:

    • Solution: Generate pH profiles of activity and maintain tight pH control

    • Validation: Develop pH-insensitive assays when possible

  • Substrate concentration effects:

    • Solution: Perform comprehensive enzyme kinetics with varying substrate concentrations

    • Validation: Use Lineweaver-Burk plots to identify non-classical kinetics

  • Protein aggregation artifacts:

    • Solution: Include detergent controls and analyze protein state by size exclusion chromatography

    • Validation: Compare activity of fresh versus stored protein preparations

  • Cofactor contamination:

    • Solution: Purify protein under denaturing conditions followed by careful refolding

    • Validation: Mass spectrometry to confirm absence of bound cofactors

Each pitfall requires specific methodological adjustments to ensure reproducible and accurate analysis of txlA activity .

How should researchers approach contradictory results when studying txlA in different experimental systems?

When facing contradictory results across experimental systems:

  • Systematic validation approach:

    • Recreate each experimental system under identical conditions

    • Test a standardized positive control across all systems

    • Implement blinded analysis protocols to minimize bias

  • Variable identification and control:

    • Construct a comprehensive table of experimental variables

    • Systematically modify one variable at a time to identify critical factors

    • Develop mathematical models to account for system-specific differences

  • Resolution strategies:

    • For expression system differences: Compare post-translational modifications by mass spectrometry

    • For activity discrepancies: Evaluate protein conformation using circular dichroism

    • For interaction inconsistencies: Employ multiple interaction detection technologies (Y2H, BiFC, co-IP)

  • Collaborative verification:

    • Exchange materials between laboratories

    • Implement standardized protocols with detailed SOPs

    • Perform multi-laboratory validation studies

  • Results integration:

    • Develop weighted analysis approaches based on methodological robustness

    • Consider biological context when interpreting system-specific results

    • Create integrated models that accommodate apparently contradictory observations

This structured approach transforms contradictions into deeper mechanistic insights .

What are the optimal long-term storage conditions for maintaining txlA protein activity?

For optimal long-term storage of txlA protein:

  • Primary storage recommendations:

    • Store lyophilized protein at -20°C/-80°C

    • For reconstituted protein, add glycerol to 50% final concentration

    • Aliquot to minimize freeze-thaw cycles

    • Use screw-cap cryovials to prevent evaporation

  • Stability enhancement strategies:

    • Add reducing agents (DTT or β-mercaptoethanol) at appropriate concentrations

    • Consider adding protease inhibitors for extended storage

    • Monitor pH stability during storage using indicator dyes

  • Quality control timeline:

    • Test activity at defined intervals (1, 3, 6, 12 months)

    • Implement activity acceptance thresholds for experimental use

    • Document batch-to-batch variation to establish realistic stability expectations

  • Alternative preservation methods:

    • Evaluate protein stability in different buffer compositions

    • Consider flash-freezing in liquid nitrogen versus slow freezing

    • Test stability at -20°C versus -80°C for cost-efficiency in long-term storage

These protocols maximize research reproducibility by ensuring consistent protein activity over time .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.