Recombinant Synechocystis sp. Thylakoid membrane protein slr1796 (slr1796)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Synechocystis sp. Thylakoid Membrane Protein slr1796

The Synechocystis sp. PCC 6803, a model cyanobacterium, has been extensively studied for its photosynthetic capabilities and potential applications in biotechnology . Among its many proteins, slr1796 is a thylakoid membrane protein that has garnered interest for its role in various cellular processes . Recombinant slr1796 refers to the protein produced using recombinant DNA technology, allowing for detailed study and manipulation of its function .

Function and Localization of slr1796

Slr1796 is involved in essential cellular processes. Research indicates that it plays a role in glycerol production from glucosylglycerol (GG) . A study showed that a mutant deficient in slr1796 could not produce glycerol when GG was added, suggesting its involvement in GG degradation .

slr0151 and Thylakoid Membrane

The tetratricopeptide repeat (TPR) protein Slr0151 from Synechocystis sp. PCC 6803 has been shown to have a repair function under high light conditions . Inactivation of slr0151 affects thylakoid membrane ultrastructure even under normal light conditions .

Experimental Analysis and Findings

5.1. Impact of slr1670 on Glycerol Production

StrainExtracellular Glycerol Concentration
Wild TypeIncreased
ggpS disruption strainLower than wild type
Δ glpK strainIncreased, comparable to wild type
slr1670 disruption mutantNo glycerol formed

These results indicate that Slr1670 (another protein) is essential for the degradation of GG to glycerol .

5.2. Localization of Slr0151

Slr0151 is found in both the plasma membrane (PM) and thylakoid membranes (TMs) . Further fractionation revealed that Slr0151 is present in PratA-defined biogenic membranes (PDMs) and TMs, indicating a broad distribution throughout the cell .

5.3. Molecular Phenotype of slr0151

The slr0151 open reading frame encodes a protein of 320 amino acids, containing two consecutive TPR domains . Disruption of the slr0151 reading frame leads to significant changes in thylakoid membrane structure, affecting the assembly and repair of photosystem II (PSII) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
slr1796; Thylakoid membrane protein slr1796
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
slr1796
Target Protein Sequence
MIMSVCLPWLARCRRFLIVSLAFAMLLLGIWGTLPFSLSDHGTAIAALEDDRYDGNIFVV YAGNGSLVPPRLNLRESFERKLPVILVYYLDDSKDCKQYAFIVSRMQEFYGRVASIIPVS VDSIPDQKRFRRDEPGYYYSGGVPQTVILDKSGKKIFDAQGALKFEVVDDVLRDLFDLLP RSESMELKQRTYNEFNSELVD
Uniprot No.

Target Background

Database Links
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is the function of slr1796 in Synechocystis sp. PCC 6803?

Slr1796 is a novel thylakoid membrane protein specifically required for the normal accumulation of Photosystem I (PSI) in Synechocystis sp. PCC 6803. Research has demonstrated that this protein regulates PSI content without significantly affecting other photosynthetic complexes such as Photosystem II (PSII) or phycobilisomes . Experimental evidence from slr1796 deletion mutants shows a dramatic reduction in PSI subunits while other photosynthetic components remain largely unaffected or slightly increased . The protein appears to function at a posttranscriptional level, as transcript abundances of PSI and PSII genes remain unchanged in the deletion mutant, suggesting slr1796 influences protein synthesis, assembly, or stability rather than gene expression .

How does the deletion of slr1796 affect photosynthetic activity?

When slr1796 is deleted, PSI activity is reduced to approximately 64% of wild-type levels, while PSII activity is slightly higher than in wild-type cells . Net photosynthesis decreases to about 67% of wild-type levels. This differential impact demonstrates the specific role of slr1796 in PSI accumulation and function. The photosynthetic phenotype of Δslr1796 mutants includes:

ParameterWild TypeΔslr1796 MutantRelative Change
PSI Activity100%~64%36% decrease
PSII Activity100%>100%Slight increase
Net Photosynthesis100%~67%33% decrease
Chlorophyll ContentNormalReducedSignificant decrease
PC/Chl RatioNormalIncreasedSignificant increase

These measurements provide clear evidence that slr1796 specifically affects PSI rather than causing general photosynthetic impairment .

What experimental approaches are recommended for studying slr1796?

For effective study of slr1796, a multifaceted experimental approach is recommended:

  • Gene disruption and complementation studies to establish protein function

  • Spectroscopic analysis (e.g., low-temperature chlorophyll fluorescence) to assess photosystem stoichiometry

  • Oxygen evolution and consumption measurements to quantify photosynthetic activity

  • Immunoblotting to determine protein levels of photosystem components

  • RT-PCR to analyze transcript abundances

  • Transmission electron microscopy to examine thylakoid ultrastructure

These methods should be combined to provide a comprehensive understanding of slr1796 function. When conducting gene disruption experiments, it's crucial to create a complementation strain to verify phenotypes are specifically due to the target mutation rather than secondary effects . For photosynthetic activity measurements, normalize data appropriately (per cell or per chlorophyll) and be aware that total chlorophyll content differs significantly between wild-type and mutant strains .

How does slr1796 regulate PSI accumulation at a posttranscriptional level?

The mechanism by which slr1796 regulates PSI accumulation appears to operate at a posttranscriptional level. RT-PCR analysis shows that transcript abundances of PSI subunits, PSI assembly factors, and PSII subunits remain unchanged in Δslr1796 mutants compared to wild-type . Despite this, immunoblotting reveals dramatically decreased levels of PSI subunits in the mutant, particularly the reaction center proteins PsaA and PsaB .

Several possible mechanisms could explain this posttranscriptional regulation:

  • Translation regulation: Slr1796 may facilitate the translation of PSI transcripts into proteins.

  • Protein stability: Slr1796 could protect PSI subunits from degradation.

  • Assembly assistance: The protein might function as an assembly factor or stabilize other assembly factors.

  • Redox regulation: Given its description as a "redoxin," slr1796 may modulate redox conditions necessary for PSI assembly or stability .

To investigate these possibilities, researchers should consider pulse-chase experiments to track protein synthesis and degradation rates, co-immunoprecipitation to identify interaction partners, and redox manipulation experiments to test environmental sensitivity. The differential decrease in various PSI subunits (ranging from ~15% to ~36% of wild-type levels) suggests complex regulatory effects that merit detailed investigation .

What is the relationship between slr1796 and thylakoid membrane architecture?

Transmission electron microscopy (TEM) reveals that deletion of slr1796 profoundly affects thylakoid membrane ultrastructure. Specifically, Δslr1796 mutants display:

  • Less extensive thylakoid membrane systems

  • Shortened membrane segments (400-700 nm) compared to long concentric layers in wild-type

  • Increased interthylakoidal distance (68±9 nm vs. 40±8 nm in wild-type)

The relationship between these structural changes and PSI reduction poses an interesting research question. Two main hypotheses emerge:

Direct involvement hypothesis: Slr1796 directly participates in thylakoid membrane organization, and its absence disrupts membrane architecture, consequently affecting PSI.

Indirect effect hypothesis: The loss of PSI complexes due to slr1796 deletion decreases total thylakoid membrane content, resulting in the observed structural changes.

Evidence supports the indirect effect hypothesis, as the complemented strain shows restoration of both PSI levels and near wild-type thylakoid spacing (51±6 nm) . To further investigate this relationship, researchers should examine other PSI-deficient mutants to determine if similar ultrastructural changes occur, and use immuno-gold labeling to localize slr1796 within the thylakoid membrane system.

How does slr1796 compare to other factors involved in PSI assembly or stability?

Several factors involved in PSI assembly or stability have been identified in Synechocystis, including BtpA, Ycf3, and Ycf4. Interestingly, while PSI subunits are dramatically reduced in Δslr1796 mutants, the levels of these assembly factors are slightly increased . This suggests slr1796 functions differently from known assembly factors.

Comparative characteristics include:

FactorEffect on PSIEffect on PSIIMechanismLocation
slr1796Major reductionMinimal effectPosttranscriptionalThylakoid membrane
BtpARequired for stabilityMinor effectRNA processingThylakoid membrane
Ycf3Essential for assemblyNo direct effectAssembly chaperoneThylakoid membrane
Ycf4Required for assemblyNo direct effectAssembly factorThylakoid membrane

The distinct pattern of slr1796 effects, particularly its specificity for PSI without affecting assembly factors, suggests it may function downstream of initial assembly processes, perhaps in stabilizing fully assembled PSI complexes or in mediating their proper integration into the thylakoid membrane . Research using double mutants (e.g., Δslr1796/ΔYcf3) could help elucidate the epistatic relationships between these factors.

How should researchers design experiments to study the role of slr1796 in thylakoid membrane contact sites?

When investigating slr1796's potential role in thylakoid membrane contact sites, researchers should implement a comprehensive experimental approach:

  • Generation of fluorescently tagged slr1796: Create fusion proteins with fluorescent tags to visualize localization within the cell, particularly in relation to thylakoid convergence membranes (TCMs) and thylapses.

  • Correlative light-electron microscopy: Combine fluorescence microscopy with TEM to precisely localize slr1796 within the thylakoid ultrastructure . This approach has been successfully used to identify proteins involved in thylakoid-plasma membrane contact sites.

  • Co-localization studies: Examine the spatial relationship between slr1796 and known proteins involved in thylakoid convergence and plasma membrane attachment, such as CurT and AncM .

  • Genetic interaction studies: Create double mutants lacking both slr1796 and other proteins involved in thylakoid organization (e.g., Δslr1796/ΔCurT or Δslr1796/ΔAncM) to assess epistatic relationships.

  • Membrane fractionation: Isolate different membrane fractions to determine the specific localization of slr1796 within the thylakoid system, particularly whether it concentrates at contact sites or convergence zones .

For experimental rigor, follow the guidelines for well-designed studies outlined in experimental methodology literature, including appropriate controls, replication, and statistical analyses .

What techniques are optimal for analyzing the impact of slr1796 mutations on PSI complex assembly?

To thoroughly investigate how slr1796 affects PSI complex assembly, researchers should employ multiple complementary techniques:

  • Blue native gel electrophoresis: Separate intact protein complexes to assess PSI assembly intermediates and completed complexes in wild-type versus mutant strains.

  • Sucrose gradient ultracentrifugation: Fractionate thylakoid membranes to isolate and quantify PSI complexes at different assembly stages.

  • Pulse-chase labeling: Track the synthesis, assembly, and turnover rates of PSI subunits using radioactive or stable isotope labeling.

  • Co-immunoprecipitation (Co-IP): Identify proteins that interact with slr1796 to elucidate its role in the assembly process.

  • Mass spectrometry-based proteomics: Quantify changes in the proteome of Δslr1796 mutants, focusing on PSI subunits and assembly factors.

  • Cryo-electron microscopy: Examine structural differences in PSI complexes between wild-type and mutant strains.

  • Time-resolved spectroscopy: Assess PSI function and assembly in real-time.

For optimal results, researchers should normalize data appropriately, recognizing that traditional chlorophyll-based normalization may be problematic given the reduced chlorophyll content in Δslr1796 mutants. Instead, consider normalizing to cell number, total protein content, or PSII content .

How can researchers effectively measure changes in thylakoid ultrastructure in slr1796 mutants?

Accurate assessment of thylakoid ultrastructural changes requires advanced imaging and quantification methodologies:

  • High-pressure freezing and freeze substitution: These techniques provide superior preservation of membrane structures compared to chemical fixation, reducing artifacts.

  • Tomographic TEM analysis: Generate 3D reconstructions of thylakoid membranes to fully characterize architectural changes.

  • Quantitative measurements: Systematically measure key parameters including:

    • Interthylakoidal distances (reported as 68±9 nm in Δslr1796 vs. 40±8 nm in wild-type)

    • Thylakoid membrane segment lengths

    • Number of membrane layers

    • Frequency of convergence sites

    • Total thylakoid membrane surface area

  • Digital image analysis: Use specialized software to ensure objective quantification of ultrastructural parameters.

  • Statistical analysis: Apply appropriate statistical tests to determine the significance of observed differences.

  • Correlative microscopy: Combine fluorescence microscopy with electron microscopy to relate protein localization to ultrastructural features .

When publishing results, present quantitative data in table format, showing measurements from multiple cells (n≥30) with appropriate statistical analyses, as exemplified in studies of thylakoid ultrastructure .

How should researchers address data contradictions between PSI protein levels and activity measurements?

When analyzing slr1796 research, a notable inconsistency appears: while PSI protein levels (especially PsaA/B) decrease to approximately 30% of wild-type levels in Δslr1796 mutants, PSI activity remains at about 64% of wild-type . This discrepancy requires careful consideration during data interpretation.

Several approaches to address this contradiction include:

  • Differential subunit analysis: Examine the relative reduction of different PSI subunits. The research shows varying levels of reduction among subunits (from ~15% to ~36% of wild-type levels) . Certain critical subunits may disproportionately influence activity measurements.

  • Methodological considerations: Evaluate whether the methyl viologen-dependent PSI activity assay might be affected by structural changes in the Δslr1796 mutant. The research suggests that reduced PsaE levels might increase access for electron acceptors like methyl viologen, potentially inflating activity measurements .

  • Compensatory mechanisms: Investigate whether the remaining PSI complexes in the mutant have enhanced activity to partially compensate for reduced numbers.

  • Normalization analysis: Perform multiple normalizations (per cell, per chlorophyll, per total membrane protein) to ensure robust comparisons between wild-type and mutant strains.

  • Statistical validation: Apply statistical methods to determine if the apparent discrepancy exceeds expected experimental variation.

When interpreting such data, researchers should explicitly acknowledge these contradictions and present multiple working hypotheses to explain them rather than selectively reporting data that supports a single narrative .

What are the most effective strategies for investigating the redox properties of slr1796?

Given slr1796's description as a "novel redoxin" , investigating its redox properties requires specialized approaches:

  • Sequence analysis and structural prediction: Identify conserved cysteine residues or other redox-active motifs that might participate in thiol-disulfide exchange reactions.

  • Site-directed mutagenesis: Systematically mutate potential redox-active sites and assess functional consequences.

  • Redox state analysis: Use alkylation agents like N-ethylmaleimide (NEM) to trap the protein in different redox states, followed by gel mobility shift assays to visualize these states.

  • In vitro redox titrations: Determine the midpoint redox potential of purified slr1796 to assess its likely redox activity range in vivo.

  • Identification of redox partners: Use techniques such as redox-dependent proximity labeling to identify proteins that interact with slr1796 in a redox-dependent manner.

  • Environmental manipulation: Test how changing cellular redox conditions (e.g., oxidative stress, altered light regimes, anaerobiosis) affects slr1796 function and PSI accumulation.

  • Thioredoxin interaction assays: Determine if slr1796 can be reduced by thioredoxins or other cellular redox proteins.

Data should be presented in both tabular and graphical formats, clearly showing how redox conditions correlate with PSI accumulation, protein interactions, and thylakoid ultrastructure .

What are the most promising avenues for future research on slr1796?

Based on current knowledge, several high-priority research directions for slr1796 include:

  • Mechanism of PSI regulation: Determine precisely how slr1796 controls PSI accumulation at the posttranscriptional level. Is it involved in translation, protein stability, or assembly processes?

  • Structural biology: Resolve the three-dimensional structure of slr1796 to gain insights into its functional domains and potential interaction surfaces.

  • Redox function characterization: Investigate the specific redox reactions catalyzed by slr1796 and identify its physiological electron donors and acceptors.

  • Integration with thylakoid biogenesis pathways: Explore how slr1796 coordinates with membrane biogenesis factors to influence thylakoid architecture.

  • Evolutionary conservation: Analyze homologs in other photosynthetic organisms to understand the conservation and divergence of slr1796 function.

  • Environmental responses: Examine how changing environmental conditions (light intensity, quality, nutrient availability) affect slr1796 expression and function.

  • Connection to thylakoid convergence membranes: Investigate potential roles in thylakoid-plasma membrane contact sites (thylapses) similar to proteins like AncM .

These research directions should employ the experimental design and methodology approaches outlined in Section 3, with particular attention to distinguishing direct effects from indirect consequences of PSI reduction .

How can researchers effectively integrate slr1796 studies with broader investigations of thylakoid membrane organization?

To position slr1796 research within the larger context of thylakoid membrane organization, researchers should:

  • Comparative studies with known factors: Systematically compare slr1796 with established thylakoid organization proteins like CurT and AncM . These proteins have been shown to influence thylakoid convergence membranes (TCMs) and thylakoid-plasma membrane contact sites.

  • Spatiotemporal analysis: Investigate the dynamic localization of slr1796 during different growth phases and in response to environmental changes, particularly in relation to sites of thylakoid biogenesis and PSI assembly.

  • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics data to create comprehensive models of how slr1796 fits within cellular regulatory networks.

  • Systems biology approach: Develop mathematical models of thylakoid membrane biogenesis and maintenance that incorporate slr1796 function.

  • Cross-species comparison: Expand studies to other cyanobacterial species and chloroplasts to determine if slr1796's role in thylakoid organization is conserved.

  • Advanced imaging techniques: Employ super-resolution microscopy and correlative light-electron microscopy approaches to visualize slr1796 in relation to thylakoid ultrastructure .

Researchers should adopt methodological best practices from implementation science, including stepped wedge designs or other quasi-experimental approaches when appropriate, to ensure robust, reproducible findings that can be effectively integrated across studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.