Recombinant Synechocystis sp. Thylakoid membrane protein ssl2009 (ssl2009)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will then prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ssl2009; Thylakoid membrane protein ssl2009
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
ssl2009
Target Protein Sequence
MAQKDNFAGGFLLGTVIGGVVGGILGSVLANRAATQSPDREKLDTEGVGNLDSEENIELA RRRLEDKIAQLNLVIDDVRDQLGHVNELNNIKEVQEEHR
Uniprot No.

Target Background

Database Links
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is SSL2009 and how is it classified within the Synechocystis proteome?

SSL2009 is a hypothetical protein identified in the thylakoid membrane of Synechocystis sp. PCC 6803 through proteomic studies. It belongs to the category of proteins with unknown functions that have been detected in purified thylakoid membrane preparations. Proteomics approaches using MALDI-TOF MS analysis have identified numerous proteins in the thylakoid membrane, including proteins with uncharacterized functions like SSL2009 .

To characterize such proteins, researchers typically employ a multi-step approach:

  • Bioinformatic analysis of the protein sequence for conserved domains and structural predictions

  • Comparison with homologous proteins in other cyanobacteria and photosynthetic organisms

  • Construction of deletion mutants to observe phenotypic changes

  • Localization studies using protein tagging and immunodetection

  • Interaction studies to identify binding partners

These approaches can help classify SSL2009 within the functional landscape of the Synechocystis proteome, particularly in relation to photosynthetic processes.

What methods are most effective for isolating thylakoid membranes containing SSL2009?

For optimal isolation of thylakoid membranes containing SSL2009, a two-phase purification approach has proven most effective:

  • Initial separation using sucrose density centrifugation

  • Further purification via aqueous polymer two-phase partitioning

This combined method has successfully isolated highly purified thylakoid membranes from Synechocystis sp. PCC 6803, allowing identification of 76 different proteins including hypothetical proteins like SSL2009 . For detailed protocol:

  • Harvest cells at mid-logarithmic phase

  • Disrupt cells by French press or glass bead homogenization

  • Remove cell debris by low-speed centrifugation (5,000 × g, 10 min)

  • Collect membranes by ultracentrifugation (150,000 × g, 60 min)

  • Layer the membrane fraction on a discontinuous sucrose gradient

  • After centrifugation, collect the thylakoid membrane band

  • Apply the collected fraction to a two-phase system containing dextran T-500 and polyethylene glycol

  • After phase separation, collect the thylakoid membrane-enriched lower phase

This method yields highly purified thylakoid membranes suitable for proteomic analysis and subsequent SSL2009 characterization .

How can researchers predict the topology of SSL2009 in the thylakoid membrane?

Predicting SSL2009's membrane topology requires a multi-faceted approach combining computational and experimental methods:

Computational prediction:

  • Use transmembrane prediction algorithms (TMHMM, Phobius, TOPCONS)

  • Apply hydropathy plot analysis (Kyte-Doolittle)

  • Utilize homology modeling if structural homologs exist

  • Perform sequence alignments with proteins of known topology

Experimental validation:

  • Protease accessibility assays - selective degradation of exposed domains

  • Site-directed chemical labeling of accessible residues

  • Reporter fusion approaches (PhoA/LacZ or GFP fusions at different positions)

  • Cysteine scanning mutagenesis followed by accessibility studies

The sequential extraction process used in thylakoid membrane proteome studies has proven very helpful in validating transmembrane predictions for hypothetical proteins . By comparing the protein's behavior during extraction with acetone, chloroform/methanol mixtures of increasing polarity, and detergents like Triton X-114, researchers can experimentally validate computational predictions of SSL2009's membrane topology.

What expression systems are optimal for producing recombinant SSL2009 protein?

Producing functional recombinant SSL2009 presents significant challenges due to its membrane-associated nature. Based on successful approaches with similar cyanobacterial membrane proteins, the following expression systems can be considered:

  • E. coli-based expression:

    • BL21(DE3) strain with C41/C43 modifications for membrane proteins

    • Fusion with maltose-binding protein (MBP) or thioredoxin to enhance solubility

    • Expression at low temperature (16-18°C) with reduced inducer concentration

    • Use of specialized vectors with tunable promoters (pBAD, pRha)

  • Cell-free expression systems:

    • Wheat germ extract supplemented with lipid nanodiscs or detergent micelles

    • E. coli S30 extract with surfactant additives

  • Homologous expression in Synechocystis:

    • Expression under native promoter with C-terminal affinity tag

    • Controlled expression using metal-inducible promoters (petJ)

Extraction and purification protocol for E. coli-expressed SSL2009:

  • Grow cultures to mid-log phase and induce with 0.1-0.5 mM IPTG

  • Harvest cells and disrupt by sonication in buffer containing glycerol and protease inhibitors

  • Solubilize membranes with mild detergents (DDM, LDAO, or C12E8)

  • Purify using IMAC followed by size exclusion chromatography

Researchers should evaluate each system based on protein yield, proper folding, and retention of functional characteristics, as determined by spectroscopic and activity assays .

How can researchers differentiate between direct and indirect effects when analyzing SSL2009 knockout phenotypes?

Differentiating between direct and indirect effects in SSL2009 knockout studies requires a comprehensive experimental approach:

  • Create multiple independent knockout lines

    • Use different strategies: complete deletion, insertional inactivation, and CRISPR/Cas9

    • Confirm knockout status through PCR, RT-PCR, and Western blotting

  • Complementation analysis

    • Reintroduce wild-type SSL2009 under native or inducible promoter

    • Create point mutants affecting key functional domains

    • Quantify degree of phenotype rescue

  • Time-resolved analysis

    • Monitor changes in gene expression, protein levels, and phenotypes over time

    • Identify primary (early) versus secondary (late) effects

  • Metabolic profiling

    • Analyze changes in metabolite profiles using LC-MS/MS

    • Identify metabolic pathways affected by SSL2009 deletion

  • Conditional expression systems

    • Use copper- or nickel-regulated promoters for controlled expression

    • Perform rapid depletion experiments

  • Protein-protein interaction analysis

    • Identify direct interaction partners through co-immunoprecipitation

    • Verify interactions with techniques like FRET or split-GFP

When analyzing results, it's essential to distinguish between primary effects (directly resulting from SSL2009 absence) and downstream cascading effects (secondary or compensatory responses). This distinction can be particularly challenging with thylakoid membrane proteins due to their integration in complex photosynthetic machinery .

What approaches enable structural characterization of membrane-embedded SSL2009?

Structural characterization of membrane-embedded SSL2009 presents unique challenges requiring specialized approaches:

  • X-ray crystallography:

    • Solubilize SSL2009 in detergent micelles or bicelles

    • Screen multiple detergents (DDM, DM, OG) for optimal crystal formation

    • Use lipidic cubic phase (LCP) crystallization

    • Implement surface entropy reduction mutations to promote crystal contacts

  • Cryo-electron microscopy:

    • Reconstitute SSL2009 in nanodiscs or amphipols

    • Use single-particle analysis for structure determination

    • Apply tomography for in situ structural studies in thylakoid membranes

  • Nuclear magnetic resonance (NMR):

    • Express isotopically labeled protein (15N, 13C)

    • Perform solution NMR on detergent-solubilized protein

    • Use solid-state NMR for membrane-embedded analysis

  • Molecular dynamics simulations:

    • Generate homology models based on related proteins

    • Validate models with experimental constraints

    • Simulate protein behavior in lipid bilayer environment

  • Cross-linking mass spectrometry:

    • Apply chemical cross-linkers to capture protein conformations

    • Identify cross-linked residues by LC-MS/MS

    • Generate distance constraints for structural modeling

The sequential extraction strategy described in thylakoid membrane proteome studies can be adapted to optimize SSL2009 extraction while preserving structural integrity . Success in structural studies will depend on protein stability, homogeneity, and the ability to maintain native conformation throughout the purification process.

What are the most effective methods for generating antibodies against SSL2009?

Generating specific antibodies against SSL2009 requires strategic approaches to overcome challenges associated with membrane proteins:

  • Peptide-derived antibodies:

    • Select 2-3 peptide regions (15-20 amino acids) from predicted extramembrane domains

    • Prioritize regions with high antigenicity and surface accessibility

    • Synthesize peptides with terminal cysteine for carrier protein conjugation

    • Immunize rabbits with KLH-conjugated peptides using the following schedule:

      • Day 0: Primary immunization with complete Freund's adjuvant

      • Day 21: First boost with incomplete Freund's adjuvant

      • Day 42: Second boost with incomplete Freund's adjuvant

      • Day 63: Test bleed and antibody titer assessment

      • Day 70: Final bleed if titers are sufficient

  • Recombinant protein fragment antibodies:

    • Express hydrophilic domains of SSL2009 in E. coli

    • Purify under denaturing conditions using affinity chromatography

    • Refold protein if necessary and confirm proper conformation

    • Use for immunization following similar schedule as peptide approach

  • Antibody validation protocol:

    • Western blot against wild-type and SSL2009 knockout strains

    • Immunoprecipitation followed by mass spectrometry

    • Preabsorption with immunizing antigen as negative control

    • Immunocytochemistry to verify predicted cellular localization

  • Troubleshooting strategies:

    • If background is high, perform affinity purification of antibodies

    • If signal is weak, test different extraction conditions to improve protein solubilization

    • For cross-reactivity, perform additional purification against immobilized antigen

The specificity of antibodies should be validated using techniques similar to those employed in thylakoid membrane proteome studies, where protein identification was confirmed by multiple complementary approaches .

How should researchers design experiments to characterize SSL2009 interactions with other thylakoid proteins?

To thoroughly characterize SSL2009 interactions with other thylakoid proteins, a multi-tiered experimental approach is recommended:

  • In vivo proximity-based methods:

    • Split-GFP or BiFC assays for direct visualization of interactions

    • FRET-based approaches using appropriate fluorophore pairs

    • In vivo crosslinking with formaldehyde or DSP

    Protocol highlights:

    • Transform Synechocystis with constructs expressing SSL2009 and candidate partners fused to complementary fragments

    • Grow under standard conditions (30°C, continuous light at 50 μmol photons m−2 s−1)

    • Image using confocal microscopy with appropriate filters

    • Quantify interaction strength by fluorescence intensity measurements

  • Affinity purification methods:

    • Tandem affinity purification (TAP) tagging of SSL2009

    • Co-immunoprecipitation using SSL2009-specific antibodies

    • Pull-down assays with recombinant SSL2009 domains

    Sample preparation:

    • Isolate thylakoid membranes using combined sucrose density centrifugation and aqueous polymer two-phase partitioning

    • Solubilize membranes with mild detergents (digitonin, DDM)

    • Perform affinity capture under native conditions

    • Identify interaction partners by LC-MS/MS

  • In vitro interaction validation:

    • Surface plasmon resonance (SPR) for kinetic analysis

    • Microscale thermophoresis (MST) for binding affinity determination

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Functional validation of interactions:

    • Site-directed mutagenesis of predicted interaction interfaces

    • Phenotypic analysis of interaction-deficient mutants

    • Reconstitution of protein complexes in liposomes

  • Data integration and visualization:

    • Create interaction network maps with confidence scores

    • Correlate interaction data with available structural information

    • Compare with known interactions of homologous proteins

This comprehensive approach leverages techniques similar to those used in previous thylakoid membrane studies that successfully identified protein complexes and their components in Synechocystis sp. PCC 6803 .

How should researchers interpret contradictory results regarding SSL2009 localization?

Contradictory results in SSL2009 localization studies can arise from multiple factors. A systematic approach to resolving these contradictions includes:

  • Critical evaluation of methodologies:

    • Compare membrane purification protocols (differential centrifugation vs. aqueous two-phase partitioning)

    • Assess cross-contamination between membrane fractions using established markers

    • Evaluate specificity of detection methods (antibody cross-reactivity, tag interference)

  • Quantitative comparison across methods:

    MethodAdvantagesLimitationsQuantitative Assessment
    Membrane fractionationNative conditionsPotential cross-contaminationEnrichment factor calculation
    Immunogold EMDirect visualizationFixation artifactsStatistical analysis of gold particle distribution
    Fluorescent protein fusionLive cell imagingPotential mislocalizationSignal distribution quantification
    Protease protectionTopology informationIncomplete digestionDensitometric analysis of protected fragments
  • Investigate condition-dependent localization:

    • Test different growth phases (log vs. stationary)

    • Vary light conditions (intensity, quality, duration)

    • Examine stress responses (nutrient limitation, temperature)

    • Consider developmental changes

  • Reconciliation strategies:

    • Create a conditional localization model incorporating temporal and spatial dynamics

    • Consider dual localization possibilities (thylakoid subdomains, partial plasma membrane association)

    • Implement sequential extraction experiments to distinguish peripheral from integral association

    • Apply mathematical modeling to quantify protein distribution across compartments

  • Validation through functional studies:

    • Correlate localization with site-specific activity measurements

    • Use site-directed mutations affecting targeting sequences

    • Apply optogenetic approaches to manipulate protein localization

When interpreting contradictory results, researchers should consider that previous studies on Synechocystis thylakoid membranes have demonstrated that protein localization can be dynamic and influenced by extraction methodologies .

What are the common pitfalls in analyzing SSL2009 expression data and how can they be avoided?

Analysis of SSL2009 expression data presents several challenges that require careful experimental design and interpretation:

  • Reference gene selection issues:

    • Pitfall: Using unstable reference genes under experimental conditions

    • Solution: Validate multiple reference genes (rnpB, secA, petB) under specific experimental conditions

    • Implementation: Calculate stability values using geNorm or NormFinder algorithms

  • RNA extraction efficiency variations:

    • Pitfall: Inconsistent RNA yields from different treatments or growth phases

    • Solution: Implement ERCC spike-in controls for normalization

    • Implementation: Add spike-in before extraction and normalize target gene expression to spike-in recovery

  • Protein extraction bias:

    • Pitfall: Variable extraction efficiency of membrane proteins

    • Solution: Use sequential extraction methods with increasing solubilization strength

    • Implementation: Apply the five-fraction extraction protocol described in comprehensive thylakoid membrane studies

  • Post-transcriptional regulation:

    • Pitfall: Assuming correlation between mRNA and protein levels

    • Solution: Measure both transcript (RT-qPCR) and protein (Western blot) levels

    • Implementation: Calculate protein-to-mRNA ratios and monitor changes across conditions

  • Data analysis and visualization:

    Common ErrorConsequenceMitigation Strategy
    Inappropriate statistical testsFalse positives/negativesSelect tests based on data distribution
    Ignoring biological replicatesOverestimating significanceMinimum 3 biological replicates per condition
    Scale manipulation in graphsMisleading visual interpretationUse consistent scales across comparable graphs
    Ignoring outliers without justificationBiased resultsDocument criteria for outlier identification
  • Correlation with physiological parameters:

    • Pitfall: Failing to connect expression changes with functional outcomes

    • Solution: Simultaneously measure photosynthetic parameters (oxygen evolution, P700 oxidation)

    • Implementation: Perform correlation analysis between expression levels and physiological measurements

What are the future research directions for SSL2009 characterization?

The complete characterization of SSL2009 represents an important frontier in understanding thylakoid membrane function in Synechocystis sp. PCC 6803. Based on current knowledge gaps and emerging technologies, several promising research directions warrant exploration:

  • Integrative structural biology approaches:

    • Combine cryo-EM, cross-linking mass spectrometry, and computational modeling

    • Determine SSL2009 structure in different functional states

    • Map SSL2009 within the three-dimensional architecture of thylakoid membranes

  • Systems biology integration:

    • Perform multi-omics analysis (transcriptomics, proteomics, metabolomics) of SSL2009 mutants

    • Develop predictive models of SSL2009 function within photosynthetic networks

    • Apply machine learning to identify patterns in SSL2009 co-expression data

  • Environmental adaptation studies:

    • Investigate SSL2009 role under fluctuating light conditions

    • Assess function during nutrient limitation and oxidative stress

    • Examine evolutionary conservation across cyanobacterial species from diverse habitats

  • Biotechnological applications:

    • Explore SSL2009 modification for enhanced photosynthetic efficiency

    • Investigate potential as a biomarker for membrane integrity

    • Assess utility in synthetic biology applications

  • Advanced imaging techniques:

    • Apply super-resolution microscopy to visualize SSL2009 distribution

    • Use single-molecule tracking to monitor dynamics

    • Implement label-free imaging methods to minimize fusion protein artifacts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.