Recombinant Synechocystis sp. Type 4 prepilin-like proteins leader peptide-processing enzyme (hofD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
hofD; slr1120; Prepilin leader peptidase/N-methyltransferase [Includes: Leader peptidase; Prepilin peptidase; N-methyltransferase; ]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
hofD
Target Protein Sequence
MDPLIAPLAFLLAIALGCAVGSFLNVVAYRLPEGLSLVHPPSRCPHCGHRLGPKENVPVV GWLWLRGKCRWCQTAISPRYPLVEAATGFLFALTCWRFGWQWQTFGYWILISFLISLTLI DWDTMTLPNSLTKPGLVLGLLFHLLLGWQRGHWIVPLVEAIASAVLGLWLFDLIRMGGSL LLGREGMGDGDPKLASMVGAWLGWPSLLLTTFIACFIGSIYGGLKLLLGTLQRRQGFPFG PFLAIGALISLFWGEKLITSYLNFVTPQF
Uniprot No.

Target Background

Function

This protein plays a crucial role in type II pseudopili formation. Its function involves the proteolytic removal of leader sequences from substrate proteins, followed by the monomethylation of the α-amino group of the newly exposed N-terminal phenylalanine. These substrates include proteins essential for the biogenesis of the type II general secretory apparatus.

Database Links
Protein Families
Peptidase A24 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of prepilin peptidase (hofD/PilD) in Synechocystis sp.?

Prepilin peptidase (hofD/PilD) in Synechocystis sp. functions as an essential processing protease that removes the N-terminal signal peptide from prepilin proteins. This enzymatic cleavage is critical for the maturation of pilin subunits required for assembly of Type IV pili, which are surface-exposed filaments. The peptidase targets prepilins synthesized as longer precursors and processes them into their functional form. Research has demonstrated that this processing is not merely a structural necessity but plays a fundamental role in cellular function, as mutants lacking the PilD protease are incapable of photoautotrophic growth due to impaired function of Sec translocons, which are essential for protein transport across the membrane .

How does prepilin signal peptide processing differ from typical Sec-dependent protein secretion?

Unlike conventional Sec-dependent protein secretion where signal peptides are typically cleaved by signal peptidase after translocation, Type IV prepilin signal peptides undergo a specialized processing mechanism. In prepilin processing, the signal peptide is first exposed to the cytosolic/stromal surface of the cell membrane where it is recognized by the prepilin peptidase (hofD/PilD). According to structural studies of PilD-related aspartyl proteases, the charged prepilin signal peptide is cleaved after being exposed to this cytosolic surface . Additionally, molecular dynamics simulations have shown that the charged signal peptide rapidly attaches to the membrane surface, forming hydrogen bonds between hydroxyl groups of galactolipids and specific amino acid residues (such as Met1, Ser3, and Arg17), before becoming deeply embedded in the membrane . This distinctive processing mechanism is crucial for proper pili assembly and function.

What phenotypic changes occur in Synechocystis mutants lacking prepilin peptidase activity?

Synechocystis mutants lacking prepilin peptidase (ΔpilD) exhibit several distinct phenotypic changes:

  • Loss of photoautotrophic growth capability: The most significant change is the inability to grow photoautotrophically due to impaired function of Sec translocons .

  • Accumulation of prepilins: These mutants accumulate unprocessed prepilin proteins, particularly non-glycosylated PilA1 prepilin, which appears to be specifically harmful to cellular function .

  • Membrane protein synthesis attenuation: Research suggests that the restricted lateral mobility of non-glycosylated PilA1 prepilin causes its accumulation in translocon-rich membrane domains, which in turn attenuates the synthesis of critical membrane proteins .

  • Lack of functional Type IV pili: Without proper processing of pilins, these mutants cannot assemble functional pili structures, affecting related cellular functions such as motility and DNA uptake.

How do suppressor mutations restore growth in ΔpilD Synechocystis mutants?

Suppressor mutations that restore photoautotrophic growth in ΔpilD Synechocystis mutants operate through several distinct mechanisms, primarily by alleviating the detrimental effects of prepilin accumulation. Research using genome sequencing of phototrophic suppressor strains has identified secondary mutations in multiple cellular components, including:

  • SigF sigma factor: Mutations affecting this transcription factor likely alter the expression patterns of pilin and other proteins .

  • RNA polymerase γ subunit: Changes to this core component of transcriptional machinery modify gene expression profiles, potentially reducing prepilin production .

  • PilA1 signal peptide: Direct mutations in the signal peptide of the major pilin PilA1 (such as Ser3 to Gly3 substitution) prevent aberrant association with SecY translocons. Molecular dynamics simulations demonstrate that such modifications alter how the signal peptide interacts with membrane components .

  • pilA1-pilA2 intergenic region: Mutations in this regulatory region may affect the expression levels of pilins, reducing their accumulation to non-toxic levels .

These suppressor mutations collectively suggest that the primary issue in ΔpilD mutants is not the total level of prepilins but specifically the presence and accumulation of non-glycosylated PilA1 prepilin in translocon-rich membrane domains .

What is the relationship between prepilin peptidase activity and Sec translocon function in Synechocystis?

The relationship between prepilin peptidase activity and Sec translocon function represents a critical intersection of protein processing systems in Synechocystis. Research indicates this relationship involves several complex mechanisms:

  • Physical interference model: In the absence of prepilin peptidase (PilD), unprocessed prepilins—particularly non-glycosylated PilA1—accumulate in membrane domains rich in Sec translocons. This accumulation physically impedes translocon function by restricting access of other proteins to these essential secretion channels .

  • Membrane domain organization: The restricted lateral mobility of non-glycosylated PilA1 prepilin causes localized disruption of membrane architecture in regions critical for protein secretion and insertion .

  • Regulatory feedback: Impaired Sec translocon function leads to cellular stress responses that further compromise photosynthetic capacity and growth.

This relationship explains why ΔpilD mutants cannot grow photoautotrophically—the impaired protein transport through Sec translocons prevents proper assembly and maintenance of the photosynthetic apparatus, which requires continuous protein transport to thylakoid membranes.

How does glycosylation status of prepilins affect membrane dynamics and cellular toxicity?

The glycosylation status of prepilins plays a crucial role in membrane dynamics and potential cellular toxicity in Synechocystis. Research has revealed several important aspects of this relationship:

  • Membrane mobility differentiation: Non-glycosylated PilA1 prepilin demonstrates significantly restricted lateral mobility within the membrane compared to its glycosylated counterparts. This restricted movement appears to be a key factor in the harmful effects observed in ΔpilD mutants .

  • Domain-specific accumulation: Non-glycosylated prepilins tend to accumulate specifically in translocon-rich membrane domains, creating localized disruptions that impair protein transport functions .

  • Structural interaction: Molecular dynamics simulations indicate that prepilin signal peptides form specific hydrogen bonds with membrane components, particularly with the hydroxyl groups of galactolipids. These interactions are likely modified by glycosylation status, affecting how deeply the peptides embed into the membrane .

The evidence suggests that glycosylation serves as a critical modification that prevents toxic accumulation of prepilins in vital membrane domains, maintaining proper membrane fluidity and organization essential for translocon function.

What are the optimal strategies for generating and isolating ΔpilD suppressor mutants in Synechocystis?

Generating and isolating ΔpilD suppressor mutants in Synechocystis requires a systematic approach combining genetic manipulation and selective growth conditions. The following methodology has proven effective:

  • Initial ΔpilD mutant generation:

    • Create a complete deletion or disruption of the pilD gene using standard homologous recombination techniques

    • Confirm deletion using PCR, sequencing, and Western blot analysis to verify absence of PilD protease

  • Suppressor selection strategy:

    • Culture the verified ΔpilD mutants under mixotrophic conditions (with glucose supplementation)

    • Gradually transition to selective photoautotrophic conditions by:
      a) Reducing glucose concentration incrementally
      b) Increasing light intensity gradually
      c) Using BG-11 medium without organic carbon sources for final selection

  • Isolation and verification:

    • Isolate colonies that demonstrate restored photoautotrophic growth

    • Perform streak purification through multiple generations to ensure genetic stability

    • Verify photoautotrophic growth rates compared to wild-type strains

    • Conduct whole genome sequencing to identify suppressor mutations

  • Classification of suppressors:

    • Group isolates based on growth rates, pigmentation, and other phenotypic characteristics

    • Perform comparative genomic analysis to identify mutation patterns

    • Validate the role of identified mutations through targeted reconstruction experiments

This approach has successfully yielded suppressor strains with mutations in the SigF sigma factor, RNA polymerase γ subunit, PilA1 signal peptide, and the pilA1-pilA2 intergenic region .

How can molecular dynamics simulations be effectively designed to study prepilin-membrane interactions?

Designing effective molecular dynamics (MD) simulations to study prepilin-membrane interactions requires careful consideration of multiple parameters to ensure biological relevance and computational feasibility:

  • System preparation and parameters:

    • Membrane composition: Create a model that accurately reflects the Synechocystis membrane lipid composition, including appropriate galactolipids, phospholipids, and other membrane components

    • Prepilin construction: Build accurate models of wild-type and mutant prepilin proteins (including the signal peptide) based on available structural data

    • Starting configurations: Position the signal peptide exposed to the cytosolic surface as the initial state

    • Simulation box: Include sufficient water molecules and counterions to neutralize the system

  • Simulation protocols:

    • Equilibration: Perform graduated restraint release during initial equilibration (typically 10-20 ns)

    • Production run: Execute long simulations (minimum 0.5 μs) to capture complete interaction dynamics

    • Temperature and pressure: Maintain physiologically relevant conditions (303K, 1 atm)

  • Analysis approaches:

    • Hydrogen bond analysis: Track formation and stability of hydrogen bonds between prepilin residues and membrane components, focusing on interactions with hydroxyl groups of galactolipids

    • Peptide embedding depth: Measure the depth of signal peptide penetration into the membrane over time

    • Lateral mobility: Calculate diffusion coefficients to quantify mobility differences between glycosylated and non-glycosylated variants

    • Contact map analysis: Identify key residues (such as Met1, Ser3, and Arg17) involved in membrane interactions

  • Validation methods:

    • Compare simulation predictions with experimental mutagenesis results

    • Perform parallel simulations of known suppressor mutants (e.g., Ser3Gly) to correlate structural changes with phenotypic effects

This simulation approach has successfully revealed how wild-type signal peptides rapidly attach to and embed within the membrane, providing insights into the molecular basis of prepilin-membrane interactions .

What experimental design considerations are crucial when studying the impact of prepilin mutations on Sec translocon function?

When investigating how prepilin mutations affect Sec translocon function, several critical experimental design considerations must be addressed:

  • Control variable management:

    • Maintain consistent growth conditions: Temperature, light intensity, and medium composition must be standardized across all experimental groups to prevent external factors from affecting results

    • Use appropriate genetic backgrounds: Include isogenic control strains differing only in the targeted mutation to isolate the effects of specific prepilin alterations

    • Account for pleiotropic effects: Consider that mutations may affect multiple cellular processes beyond Sec translocon function

  • Independent variable selection:

    • Targeted mutation design: Create a series of prepilin mutations affecting different domains (signal sequence, mature domain, glycosylation sites) to distinguish domain-specific effects

    • Expression level control: Utilize inducible promoters to test whether phenotypes are concentration-dependent

    • Mutation combinations: Test suppressor mutations in combination to assess epistatic relationships

  • Dependent variable measurement:

    • Growth rate quantification: Monitor photoautotrophic and mixotrophic growth using standardized methods (optical density, biomass determination)

    • Protein translocation efficiency: Use reporter proteins to directly measure Sec-dependent protein transport

    • Membrane protein analysis: Perform quantitative proteomic analysis of membrane fractions to measure global effects on protein insertion

  • Statistical design optimization:

    • Employ factorial design: Test multiple variables simultaneously to detect interaction effects

    • Determine appropriate replicate numbers: Conduct power analysis to ensure sufficient statistical sensitivity

    • Implement randomization: Minimize systematic bias by randomizing sample processing order

  • Control experiments:

    • Test membrane integrity: Ensure mutations do not cause general membrane disruption using fluorescent dyes

    • Assess protein stability: Verify that mutant prepilins have similar half-lives to wild-type proteins

    • Measure translocon abundance: Confirm that effects are due to translocon function rather than changes in translocon levels

This systematic experimental approach ensures valid, reliable, and replicable results when investigating the complex relationship between prepilin mutations and Sec translocon function .

How can researchers troubleshoot expression issues when attempting to produce recombinant hofD/PilD in heterologous systems?

Troubleshooting expression issues for recombinant hofD/PilD production in heterologous systems requires a systematic approach addressing multiple potential bottlenecks:

  • Codon optimization strategies:

    • Targeted approach: Unlike the variable results seen with IFN in Synechocystis , hofD expression benefits from comprehensive codon optimization tailored to the expression host

    • Rare codon analysis: Identify and replace rare codons, particularly those in clusters that may cause ribosomal pausing

    • Codon adaptation index (CAI): Target a minimum CAI of 0.8 for improved expression levels

  • Fusion tag selection matrix:

    Fusion PartnerSolubility EnhancementPurification MethodCleavage OptionsHost System Compatibility
    CpcBHighChromatographyFactor XaCyanobacteria
    His-tagMinimalIMACTEV/ThrombinUniversal
    MBPVery HighAmylose resinFactor Xa/TEVE. coli preferred
    SUMOHighIMAC (via His)SUMO proteaseUniversal
    NptIModerateKanamycin affinityVariousBacteria

    This approach mirrors successful strategies used for other difficult-to-express proteins in Synechocystis, where fusion constructs (like CpcB) significantly enhanced recombinant protein accumulation .

  • Expression optimization parameters:

    • Temperature modulation: Test reduced temperatures (16-25°C) to improve folding

    • Induction timing: Optimize cell density at induction (typically mid-log phase)

    • Inducer concentration: Titrate inducer levels to prevent toxic overexpression

    • Media formulation: Test specialized media with osmolytes or chaperone-inducing components

  • Membrane protein-specific considerations:

    • Detergent screening: Systematically test different detergent classes for extraction efficiency

    • Lipid supplementation: Add specific lipids during extraction to maintain native-like environment

    • Directed evolution approach: Consider creating libraries with random mutations to select for better-expressing variants

  • Expression verification techniques:

    • Western blot optimization: Use specific antibodies against both N and C-terminal regions

    • Activity assays: Develop in vitro processing assays using synthetic prepilin substrates

    • Mass spectrometry: Confirm protein identity even at low expression levels

Learning from the fusion construct technology successfully applied for human interferon expression in Synechocystis , researchers should prioritize testing multiple fusion partners simultaneously to identify optimal combinations for hofD/PilD expression.

What approaches can resolve conflicting data regarding the role of prepilin accumulation in cellular toxicity?

Resolving conflicting data regarding prepilin accumulation and cellular toxicity requires multifaceted experimental approaches that address various aspects of the phenomenon:

  • Quantitative correlation analysis:

    • Develop precise quantification methods for different prepilin species using targeted mass spectrometry

    • Establish dose-response relationships between prepilin levels and growth inhibition

    • Create calibration curves correlating prepilin concentration with specific cellular defects

  • Discriminating between competing hypotheses:

    HypothesisExperimental ApproachExpected Outcome if TrueControls Needed
    Total prepilin burden is toxicControlled expression of various prepilinsAll prepilins equally toxic at same molar concentrationNon-prepilin membrane proteins
    Specific prepilin (PilA1) is uniquely toxicExpress individual prepilins separatelyOnly PilA1 causes growth defectsMultiple prepilin types
    Glycosylation status determines toxicityExpress glycosylation variantsNon-glycosylated variants show higher toxicityGlycosylation site mutants
    Membrane domain localization causes toxicityMembrane fractionation + prepilin quantificationToxic correlation only in specific membrane fractionsMembrane domain markers
  • Suppressor mutation mechanism analysis:

    • Generate defined mutations matching those found in suppressor strains

    • Test combinations of mutations to identify synergistic or antagonistic effects

    • Perform epistasis analysis to establish hierarchical relationships between different suppressors

  • Advanced imaging approaches:

    • Use super-resolution microscopy to visualize prepilin distribution in membrane microdomains

    • Implement FRET-based assays to measure prepilin-translocon interactions in vivo

    • Apply single-molecule tracking to quantify differences in lateral mobility between prepilin variants

  • Computational validation:

    • Build systems biology models incorporating multiple datasets

    • Use Bayesian analysis to determine the probability of competing hypotheses

    • Perform sensitivity analysis to identify parameters with greatest influence on outcomes

The research suggests that, rather than total prepilin levels, the presence of non-glycosylated PilA1 prepilin specifically in translocon-rich membrane domains is the primary cause of toxicity . This hypothesis can be further validated using the approaches above.

How can researchers distinguish between direct and indirect effects of hofD/PilD mutation on cellular physiology?

Distinguishing between direct and indirect effects of hofD/PilD mutation requires carefully designed experiments that separate immediate consequences from downstream physiological adaptations:

  • Temporal analysis of cellular responses:

    • Time-course experiments: Monitor changes in cellular parameters at multiple time points following inducible deletion of hofD/PilD

    • Pulse-chase studies: Track the fate of newly synthesized proteins to identify immediate translocation defects

    • Early response transcriptomics: Analyze gene expression changes within minutes to hours of hofD/PilD inactivation

  • Conditional mutation systems:

    • Temperature-sensitive alleles: Engineer conditional hofD/PilD variants that lose function upon temperature shift

    • Chemical-inducible degradation: Tag hofD/PilD with domains allowing rapid protein depletion upon chemical addition

    • CRISPR interference: Use inducible dCas9-based repression for titratable hofD/PilD reduction

  • Isolation of effect categories:

    Effect CategoryExperimental ApproachKey Markers/MeasurementsControl System
    Direct processing defectsIn vitro processing assaysPrepilin processing efficiencyPurified components
    Membrane organization effectsMembrane fluidity measurementsFluorescence anisotropy changesArtificial membrane systems
    Translocon impairmentSec-dependent protein transportReporter protein localizationSecY mutants
    Stress responsesStress-responsive promoter reportersHeat shock protein inductionKnown stress inducers
    Metabolic adaptationsMetabolomic analysisCentral carbon metabolite shiftsCarbon source variations
  • Bypass experiments:

    • Genetic suppression: Identify mutations that specifically rescue individual aspects of the phenotype

    • Metabolic engineering: Provide alternative pathways for affected metabolic processes

    • Translocon overexpression: Test if increased translocon levels can overcome specific defects

  • Comparative analysis across species:

    • Study hofD/PilD mutation effects in related cyanobacteria with different physiological characteristics

    • Identify conserved vs. species-specific responses

    • Implement heterologous expression of hofD/PilD variants to isolate protein-specific functions

Research indicates that in Synechocystis, the primary direct effect of PilD deletion is prepilin accumulation, while the inability to grow photoautotrophically represents an indirect effect mediated through impaired Sec translocon function . This methodology allows researchers to build causal chains connecting immediate molecular events to downstream physiological consequences.

What emerging methodologies might advance our understanding of hofD/PilD function and prepilin processing?

Several cutting-edge methodologies hold promise for significantly advancing our understanding of hofD/PilD function and prepilin processing mechanisms:

  • Cryo-electron microscopy approaches:

    • Single-particle analysis: Determine high-resolution structures of hofD/PilD in complex with prepilin substrates

    • Tomography: Visualize the native membrane environment and spatial organization of processing complexes

    • In situ structural biology: Capture transient processing intermediates within intact cells

  • Advanced genetic tools:

    • CRISPR-based screening: Perform genome-wide screens for genes affecting hofD/PilD function

    • Saturation mutagenesis: Create comprehensive libraries of hofD/PilD and prepilin variants to map functional domains

    • Synthetic biology approaches: Reconstruct minimal prepilin processing systems in heterologous hosts

  • Real-time monitoring technologies:

    • Single-molecule FRET: Measure conformational changes during prepilin processing in real-time

    • Microfluidics-based assays: Track processing kinetics at the single-cell level

    • Biosensors: Develop fluorescent reporters that respond to prepilin accumulation or processing

  • Integrative multi-omics:

    ApproachApplication to hofD/PilD ResearchExpected Insights
    Spatial proteomicsMap protein distributions in membrane subdomainsIdentify processing microenvironments
    Protein interactomicsCharacterize hofD/PilD interaction networksDiscover regulatory partnerships
    GlycoproteomicsProfile prepilin glycosylation patternsUnderstand modification-function relationships
    Systems modelingIntegrate multiple data typesPredict system-wide effects of perturbations
  • Cross-species comparative biology:

    • Evolutionary analysis: Trace the co-evolution of prepilins and processing enzymes

    • Functional complementation: Test interchangeability of components across bacterial species

    • Synthetic hybrid systems: Create chimeric processing machinery to isolate functional domains

These emerging approaches will help address crucial knowledge gaps, similar to how fusion construct technology advanced the understanding of recombinant protein production in Synechocystis , potentially leading to breakthroughs in both fundamental understanding and biotechnological applications of prepilin processing systems.

How might research on hofD/PilD contribute to understanding bacterial secretion system evolution?

Research on hofD/PilD can provide crucial insights into the evolutionary development of bacterial secretion systems through several interconnected approaches:

  • Comparative genomics and phylogenetics:

    • Ancestral sequence reconstruction: Infer the evolutionary history of hofD/PilD and related peptidases

    • Gene neighborhood analysis: Track the co-evolution of processing enzymes with their cognate secretion systems

    • Horizontal gene transfer assessment: Identify instances of secretion system component exchange between bacterial lineages

  • Structure-function relationship mapping:

    • Domain conservation analysis: Compare conserved vs. variable regions across diverse bacterial phyla

    • Active site evolution: Trace the development of catalytic mechanisms in prepilin peptidases

    • Substrate recognition determinants: Identify how specificity has evolved across different bacterial groups

  • Evolutionary model development:

    Evolutionary ModelTestable PredictionsExperimental Approaches
    Common ancestry of Type II/IV systemsShared core componentsFunctional complementation tests
    Modular evolutionRecombination hotspotsDomain swapping experiments
    Convergent evolutionIndependent functional solutionsStructural comparison of distantly related systems
    Co-evolution with substrate proteinsCorrelated mutation patternsStatistical coupling analysis
  • Minimal system reconstruction:

    • Determine the essential components required for prepilin processing and assembly

    • Test functionality of simplified ancestral-like systems

    • Establish the sequence of evolutionary innovations that led to current diversity

  • Cross-domain comparative analysis:

    • Examine relationships between bacterial prepilin peptidases and archaeal flagellin processing enzymes

    • Investigate potential evolutionary links to eukaryotic signal peptidases

    • Identify conserved mechanisms across domains of life

This research direction extends beyond the specific findings in Synechocystis to address fundamental questions about how complex molecular machines evolve. Understanding the evolutionary trajectory of hofD/PilD and related processing enzymes will provide insights into the modular nature of bacterial secretion systems and potentially reveal new principles of molecular evolution.

How do findings from hofD/PilD research in Synechocystis inform strategies for recombinant protein expression in cyanobacteria?

Research on hofD/PilD in Synechocystis provides valuable insights that can significantly enhance recombinant protein expression strategies in cyanobacteria:

These insights from hofD/PilD research provide a foundation for developing improved expression systems in cyanobacteria, potentially enabling these photosynthetic organisms to become efficient biofactories for complex proteins.

What interdisciplinary connections can be drawn between hofD/PilD research and broader fields in microbiology?

HofD/PilD research in Synechocystis connects to multiple fields in microbiology through interdisciplinary relationships that enhance our understanding of fundamental biological processes:

  • Bacterial cell envelope biogenesis:

    • Membrane protein quality control: Research on prepilin accumulation toxicity provides insights into how cells manage membrane protein overload

    • Lipid-protein interactions: The observed interactions between prepilin signal peptides and membrane lipids illuminate general principles of membrane protein integration

    • Compartmentalization mechanisms: Understanding how prepilins and processing enzymes localize to specific membrane domains informs broader questions about bacterial membrane organization

  • Stress response and adaptation mechanisms:

    • Membrane stress responses: The cellular responses to prepilin accumulation reveal pathways that sense and respond to membrane protein misfolding

    • Suppressor mutation mechanisms: The diverse suppressor mutations identified in ΔpilD strains demonstrate the remarkable adaptability of bacterial systems

    • Photoautotrophic growth regulation: Connections between protein secretion and photosynthetic capacity highlight the integrated nature of cellular processes

  • Protein translocation system interactions:

    Related SystemConnection to hofD/PilDResearch Implications
    Sec transloconImpaired by prepilin accumulationReveals unexpected interdependence of secretion systems
    Type II secretionEvolutionarily related componentsInforms understanding of secretion system evolution
    Thylakoid biogenesisDependent on functional protein transportLinks membrane protein processing to photosynthesis
    Natural competenceRequires functional Type IV piliConnects DNA uptake mechanisms to prepilin processing
  • Microbial biotechnology applications:

    • Recombinant protein production: Fusion construct technology utilizing cyanobacterial components offers new approaches for difficult-to-express proteins

    • Biopharmaceutical synthesis: The successful production of functional human interferon demonstrates the potential for cyanobacteria as expression hosts

    • Synthetic biology tools: Understanding prepilin processing offers new genetic parts for designer secretion systems

  • Evolutionary microbiology:

    • Secretion system evolution: PilD/hofD research provides insights into the evolutionary relationships between different bacterial secretion systems

    • Host-pathogen interactions: Many pathogens utilize Type IV pili for adherence and virulence, making this research relevant to infectious disease studies

    • Horizontal gene transfer mechanisms: Type IV pili involvement in natural competence connects this system to bacterial genome evolution

These interdisciplinary connections highlight how focused research on hofD/PilD contributes to our broader understanding of bacterial physiology, evolution, and potential biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.