Recombinant Synechocystis sp. Uncharacterized membrane protein sll0875 (sll0875)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format when placing your order, and we will fulfill your requirements.
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format when placing your order, and we will fulfill your requirements.
Lead Time
Delivery time
may vary depending on the purchase method and location. Please consult your local distributor
for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipment, please communicate with us in advance for an additional fee.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipment, please communicate with us in advance for an additional fee.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form maintains a shelf life of 12 months at -20°C/-80°C.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form maintains a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
sll0875; Uncharacterized membrane protein sll0875
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-258
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
sll0875
Target Protein Sequence
MDNSLLSEIWRQSLAFPWLSAVILNSFLLALAAIAPKKLLTPWGYGHAWVLGVIIWAALG
WRGYLVVLAYFFVGSAVTRIGQKEKEAAGIAEKRSGQRGPENVWGSALTAALCALAIAFG
PEPWQLWLALGYVASFSTKLSDTTASEVGKAYGKNTFLITTLQPVPRGTEGAVSVEGTLA
GFAAGLALAVLGYGVGLISFGGIIFSTLAAFIATNLESVIGATLQNKWPWLTNEVVNGIN
TFLGAAIAIGIEATAQLI
Uniprot No.
Target Background
Database Links
KEGG: syn:sll0875
STRING: 1148.SYNGTS_1021
Protein Families
TMEM19 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
