Recombinant Synechocystis sp. Uncharacterized MscS family protein slr0639 (slr0639)

Shipped with Ice Packs
In Stock

Description

Overview of Slr0639

Slr0639 is encoded by the slr0639 gene in Synechocystis sp. PCC 6803 and belongs to the MscS (mechanosensitive channel of small conductance) family. These channels are critical for rapid solute efflux during hypo-osmotic shock, preventing cell lysis . Unlike well-characterized bacterial MscS homologs, Slr0639 remains functionally understudied but shows distinct regulatory patterns under salt stress .

Functional Role in Salt Stress Response

Slr0639 is a key component of the salt-specific stimulon in Synechocystis, showing dramatic upregulation under high salinity:

Salt Acclimation Dynamics :

ParameterSlr0639 Response
mRNA fold change~2-fold increase at 4% NaCl
Protein abundance14.3-fold increase in long-term salt-acclimated cells
Functional partnersCo-regulated with Na+/H+ antiporters (NhaS2, NhaS5)

Mechanistic Insights:

  • Osmotic safety valve: Slr0639 facilitates rapid release of compatible solutes (e.g., glucosylglycerol) during hypo-osmotic shock .

  • Ion homeostasis: Works synergistically with Na+/H+ antiporters to mitigate Na+ toxicity, though direct ion transport activity remains unconfirmed .

Expression Analysis and Regulatory Networks

Integrative omics data reveal Slr0639’s coordination with broader stress response systems:

Co-regulated Pathways :

  1. Compatible solute synthesis: Coincides with elevated glucosylglycerol (GG) synthesis enzymes (GgpS/GgpP).

  2. Cell envelope remodeling: Associates with peptidoglycan biosynthesis proteins (MurF, DacB) and reduced extracellular polysaccharide (EPS) production.

  3. Redox signaling: Linked to CrhR RNA helicase, a stress-responsive regulator.

Regulatory triggers:

  • Sustained high NaCl (684 mM) induces persistent Slr0639 overexpression, unlike transient responses in other MscS homologs .

Comparative Analysis with Other MscS Proteins

Slr0639 exhibits distinct features compared to homologs in Synechocystis and other organisms:

MscS Family Members in Synechocystis 6803 :

ProteinGeneFold Change (4% NaCl)Proposed Role
Slr0639slr063914.3×Primary hypo-osmotic valve
Slr0765slr07653.2×Secondary mechanoprotection
Sll1040sll10402.1×Redox-linked stress response

Key divergence: Slr0639 lacks the extended C-terminal domain seen in E. coli MscS, potentially limiting its interaction with cytoplasmic regulators .

Research Gaps and Future Directions

  • Channel activity: Direct electrophysiological characterization (e.g., patch-clamp) is needed to confirm mechanosensitivity.

  • Structural resolution: Cryo-EM studies could elucidate oligomeric state and gating mechanics.

  • Genetic interactors: CRISPRi/a screens may identify partners in salt sensing or cell wall remodeling.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please include them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
slr0639; Uncharacterized MscS family protein slr0639
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-296
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
slr0639
Target Protein Sequence
MVNLLFLFFIMSFFPNNIFDYDQQAITDLLITASLKILFALAILLIGFWLSKRLQKLIIR ALRKSNLEPTFISFAGNISYYLLLVVFFVLCLAQLGIQTSSLVALLGASTLAIGLALQGS LANVAGGILLVLFNYFRVGERIEVAGIEGIVESIEILSTTICTYDNRLVTIPNKQIIENN IINHVGKPERRIDLVIGVGYEEDIDHVRSSLQWVIDQNSEVCTEPAPTIALGELGDSSVN FYVRPWVKSEDYFRLKLQLTEAIKRKLDEENISIPFPQRDVHLIQPETKELDIKAA
Uniprot No.

Target Background

Database Links
Protein Families
MscS (TC 1.A.23) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is the recombinant version of slr0639 typically produced for research purposes?

The recombinant slr0639 protein is typically produced using E. coli expression systems. The full-length protein (amino acids 1-296) is fused to an N-terminal His tag to facilitate purification. The expression construct is transformed into E. coli, followed by induction of protein expression under optimized conditions. After cell lysis, the His-tagged protein is purified using affinity chromatography, typically followed by size exclusion chromatography to enhance purity. The final product is often prepared as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE .

For reconstitution, the lyophilized protein should be briefly centrifuged prior to opening, then reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% before aliquoting and storing at -20°C/-80°C .

What is the physiological role of slr0639 in Synechocystis sp. in response to salt stress?

The slr0639 protein plays a crucial role in salt stress response in Synechocystis sp. As a mechanosensitive channel of small conductance (MscS), it functions as a safety valve during osmotic pressure changes. Research has shown that slr0639 accumulates to significantly high levels during salt acclimation, with a fold change of 14.3 at the protein level and approximately twofold at the RNA level in salt-stressed cells compared to control conditions .

MscS proteins like slr0639 are particularly important for proper acclimation to hypo-osmotic treatments, facilitating the quick release of compatible solutes to prevent cell bursting when environmental osmotic pressure decreases. Thus, the elevated expression of slr0639 during salt stress likely prepares the cyanobacterial cells for potential subsequent decreases in environmental osmotic pressure, providing a crucial protection mechanism .

The significant upregulation of slr0639 during salt stress, compared to other MscS proteins in Synechocystis (such as Slr0765 and Sll1040), suggests it may play a specialized or particularly important role in osmotic adaptation in this organism .

How does slr0639 compare to other mechanosensitive channel proteins in Synechocystis during salt stress?

In Synechocystis sp., several mechanosensitive channel proteins respond to salt stress, but slr0639 shows the most dramatic upregulation. Comparative analysis of protein abundances during salt acclimation reveals:

ProteinProtein FamilyFold Change During Salt StressFunction
Slr0639MscS14.3Mechanosensitive channel for osmotic regulation
Slr0765MscSElevated (specific value not provided)Mechanosensitive channel for osmotic regulation
Sll1040MscSElevated (specific value not provided)Mechanosensitive channel for osmotic regulation
Slr0875 (MscL)MscLNo significant changeInvolved in water movements after sudden osmotic shocks

This data indicates that while multiple mechanosensitive channels participate in the salt stress response, slr0639 appears to be the primary MscS protein involved in long-term salt acclimation. In contrast, MscL (Slr0875), which is crucial for sudden osmotic shocks, does not show significant changes in abundance during sustained salt stress. This suggests a specialized role for slr0639 in the long-term adaptation to high salinity conditions .

The differential regulation of these channel proteins highlights the complexity of osmotic regulation in cyanobacteria and suggests that different mechanosensitive channels may be activated under different stress conditions or at different stages of the stress response.

What are the optimal storage and handling conditions for recombinant slr0639 protein to maintain its activity?

To maintain the activity and structural integrity of recombinant slr0639 protein, researchers should follow these storage and handling guidelines:

  • Storage temperature: Store the lyophilized protein at -20°C/-80°C upon receipt. For reconstituted protein, store at -20°C/-80°C for long-term storage .

  • Aliquoting: Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles. Working aliquots can be stored at 4°C for up to one week .

  • Buffer conditions: The protein is typically stored in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0. For reconstituted protein, adding glycerol to a final concentration of 50% is recommended for enhanced stability during frozen storage .

  • Reconstitution procedure:

    • Centrifuge the vial briefly before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • For long-term storage, add glycerol to 5-50% final concentration before aliquoting

  • Freeze-thaw cycles: Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity .

  • Handling precautions: Use appropriate personal protective equipment when handling the protein. For cultures that require storage in liquid nitrogen, be aware that some vials may leak when submerged and could potentially explode upon thawing due to the conversion of liquid nitrogen to gas phase .

Following these guidelines will help ensure the stability and functional integrity of the recombinant slr0639 protein for research applications.

What expression systems are most effective for producing functional recombinant slr0639?

For producing functional recombinant slr0639, E. coli expression systems have proven effective and are the most commonly used approach. The following methodological considerations can optimize expression:

  • Expression vector selection: Vectors with strong, inducible promoters (such as T7) and appropriate fusion tags (like N-terminal His-tag) are recommended for optimal expression and subsequent purification .

  • E. coli strain selection: BL21(DE3) or its derivatives are typically used for membrane protein expression due to their reduced protease activity and ability to maintain stable plasmids.

  • Induction conditions: Lower temperatures (16-25°C) during induction often improve the folding of membrane proteins like slr0639. IPTG concentration should be optimized (typically 0.1-0.5 mM) to balance expression level with proper folding.

  • Growth media supplementation: For membrane proteins, media supplemented with glycerol (0.5-1%) and specific ions may improve functional expression.

  • Extraction and solubilization: Gentle detergents are crucial for extracting membrane proteins while maintaining their native conformation. Non-ionic detergents like n-Dodecyl β-D-maltoside (DDM) or CHAPS are often suitable for MscS family proteins.

  • Purification strategy: A two-step purification approach is recommended:

    • Initial purification using immobilized metal affinity chromatography (IMAC) leveraging the His-tag

    • Secondary purification using size exclusion chromatography to achieve >90% purity

  • Activity validation: Functional assays, such as liposome-based channel activity measurements or osmotic shock response tests, should be performed to confirm that the recombinant protein retains its mechanosensitive properties.

While E. coli remains the primary expression system, researchers investigating specific protein-protein interactions or post-translational modifications might consider expression in cyanobacterial hosts or cell-free systems for specialized applications.

What methodologies are effective for studying the mechanosensitive channel activity of slr0639 in vitro?

Investigating the mechanosensitive channel activity of slr0639 in vitro requires specialized techniques that can measure channel gating in response to membrane tension. Several methodological approaches are particularly valuable:

  • Patch-clamp electrophysiology: This gold-standard technique for ion channel characterization involves:

    • Reconstituting purified slr0639 into giant unilamellar vesicles (GUVs)

    • Forming a high-resistance seal between a glass micropipette and the membrane

    • Applying negative pressure to induce membrane tension while recording channel currents

    • Analyzing conductance, opening threshold, and ion selectivity

  • Fluorescence-based liposome assays:

    • Reconstituting slr0639 into liposomes loaded with self-quenching fluorescent dyes

    • Applying osmotic downshock to induce liposome swelling and membrane tension

    • Measuring fluorescence increase as the dye is released through open channels

    • This method allows higher throughput than patch-clamp but provides less detailed kinetic information

  • Stopped-flow spectroscopy:

    • Rapidly mixing proteoliposomes with solutions of different osmolarity

    • Measuring light scattering changes that reflect liposome volume changes

    • Calculating channel activity based on the rate of volume equilibration

  • Atomic force microscopy (AFM):

    • Imaging slr0639 channels in supported lipid bilayers

    • Applying controlled forces to investigate conformational changes

    • Combining with conductance measurements for structure-function correlations

  • Site-directed spin labeling with electron paramagnetic resonance (EPR):

    • Introducing spin labels at specific residues in slr0639

    • Measuring changes in mobility and accessibility in response to membrane tension

    • Providing insights into structural rearrangements during channel gating

When conducting these studies, it's critical to maintain appropriate lipid composition in reconstituted membranes, as lipid environment significantly affects mechanosensitive channel function. Researchers should also consider using lipids similar to those found in cyanobacterial membranes to more accurately represent the native environment of slr0639.

How can researchers effectively investigate the regulatory mechanisms controlling slr0639 expression during salt stress?

Investigating the regulatory mechanisms controlling slr0639 expression during salt stress requires a multi-faceted approach combining genomic, transcriptomic, and molecular techniques:

  • Promoter analysis and reporter assays:

    • Clone the promoter region of slr0639 upstream of reporter genes (e.g., luciferase, GFP)

    • Introduce constructs into Synechocystis cells and measure reporter activity under varying salt concentrations

    • Create promoter truncations and mutations to identify key regulatory elements

    • This approach can identify the minimal promoter region responsive to salt stress

  • Chromatin immunoprecipitation (ChIP) assays:

    • Perform ChIP experiments under normal and salt stress conditions

    • Identify transcription factors that bind to the slr0639 promoter region

    • Combine with sequencing (ChIP-seq) for genome-wide binding profiles

    • This technique can reveal direct regulators of slr0639 expression

  • Analysis of antisense RNA regulation:

    • Examine the search results showing that many genes in Synechocystis, including slr0639, may be regulated by antisense RNAs during salt stress

    • Quantify both mRNA and potential asRNA levels using strand-specific RT-qPCR

    • Investigate the correlation between asRNA and mRNA levels during salt stress response

    • Overexpress or inhibit identified asRNAs to confirm regulatory effects

  • Time-course transcriptomics and proteomics:

    • Perform RNA-seq and proteomics at multiple time points after salt stress

    • Analyze the temporal dynamics of slr0639 expression relative to other stress response genes

    • Identify co-regulated gene clusters that may share regulatory mechanisms

    • Compare mRNA and protein abundance to identify potential post-transcriptional regulation

  • Genetic approaches:

    • Create knockout mutants of candidate transcription factors

    • Measure effects on slr0639 expression using RT-qPCR

    • Complement mutants with modified versions of regulatory proteins to confirm specificity

The research indicates that slr0639 undergoes significant upregulation during salt stress (14.3-fold at protein level, approximately 2-fold at RNA level) . This discrepancy between protein and mRNA levels suggests complex post-transcriptional regulation that should be specifically investigated to fully understand the regulatory mechanisms.

How does slr0639 compare structurally and functionally with MscS family proteins in other organisms?

Structural and functional comparison of slr0639 with MscS family proteins across different organisms reveals important evolutionary insights and potential functional specializations:

  • Structural comparisons:

    • The slr0639 protein (296 amino acids) is larger than the canonical E. coli MscS (286 amino acids), suggesting potential additional domains or functional elements

    • Like other MscS proteins, slr0639 contains multiple transmembrane domains, though the exact membrane topology may differ from E. coli MscS

    • Sequence analysis indicates slr0639 shares the conserved pore-lining region characteristic of MscS channels, essential for mechanosensitive gating

  • Functional conservation:

    • MscS proteins across bacteria serve as emergency release valves during hypoosmotic shock

    • The significant upregulation of slr0639 during salt stress (14.3-fold) parallels the stress-responsive nature of MscS proteins in other organisms

    • Unlike E. coli, which has one primary MscS protein, Synechocystis has multiple MscS homologs (Slr0639, Slr0765, Sll1040), suggesting functional specialization

  • Evolutionary adaptations:

    • Cyanobacteria like Synechocystis face unique osmotic challenges due to their photosynthetic lifestyle and aquatic environments

    • The higher induction of slr0639 compared to other Synechocystis MscS proteins suggests evolutionary adaptation for specific osmotic regulation needs

    • Potential co-evolution with other salt stress response mechanisms in Synechocystis may explain functional differences from non-photosynthetic bacterial MscS proteins

  • Research methodology for comparative analysis:

    • Homology modeling based on E. coli MscS crystal structure can predict structural features of slr0639

    • Heterologous expression in MscS-deficient E. coli strains can test functional complementation

    • Chimeric proteins combining domains from different MscS homologs can identify functionally important regions

    • Electrophysiological characterization can compare conductance, gating tension threshold, and ion selectivity

Understanding these comparative aspects is crucial for interpreting the specialized role of slr0639 in Synechocystis and for developing evolutionary models of mechanosensitive channel adaptation in different bacterial lineages.

What is known about the regulation of slr0639 compared to other salt stress response proteins in Synechocystis sp.?

The regulation of slr0639 exhibits both similarities and differences compared to other salt stress response proteins in Synechocystis sp., revealing insights into the coordinated stress response mechanisms:

This comparative regulatory analysis highlights the complexity of salt stress response in Synechocystis and suggests that slr0639 may be subject to specialized regulatory mechanisms that ensure its particularly high induction during osmotic stress.

How can researchers utilize slr0639 in synthetic biology applications for creating osmotic stress-resistant organisms?

The mechanosensitive channel slr0639 presents several opportunities for engineering osmotic stress resistance in synthetic biology applications through the following methodological approaches:

  • Heterologous expression in sensitive hosts:

    • Express slr0639 in osmotically sensitive organisms like certain E. coli strains or yeast

    • Optimize codon usage and expression levels to ensure proper membrane integration

    • Validate function through growth assays under fluctuating osmotic conditions

    • This approach can create organisms better able to withstand environmental osmotic fluctuations

  • Engineering improved variants:

    • Use structure-guided mutagenesis to modify the gating threshold of slr0639

    • Screen for variants with enhanced opening properties or altered ion selectivity

    • Design chimeric channels combining functional domains from different MscS proteins

    • Methodical approaches include:

      • Error-prone PCR libraries followed by selection under osmotic stress

      • Directed evolution with iterative cycles of mutagenesis and selection

      • Rational design based on homology models and molecular dynamics simulations

  • Biosensor development:

    • Engineer slr0639-based osmotic biosensors by coupling channel activity to reporter gene expression

    • Design constructs where channel opening triggers calcium influx that activates downstream gene expression

    • Develop cell-based biosensors for environmental monitoring of osmotic fluctuations

    • This application requires careful calibration of the sensor response to different osmotic strength levels

  • Enhanced bioprocess resilience:

    • Integrate slr0639 expression systems into industrial microorganisms used in bioreactors

    • Design genetic circuits that upregulate slr0639 expression in response to osmotic shifts

    • Improve survival and productivity during fed-batch fermentation processes where media composition changes

    • Methodological validation through comparative bioprocess performance metrics

  • Stress-responsive regulatory systems:

    • Utilize the native slr0639 promoter region as a salt-responsive genetic element

    • Develop synthetic gene circuits that activate desired functions under high salt conditions

    • Create oscillatory systems that respond dynamically to changing osmotic environments

    • Test functionality through microfluidic devices that can rapidly alter osmotic conditions

For all these applications, researchers should implement systematic characterization of the engineered systems, including quantitative assessment of growth rates, survival percentages, and productivity under defined osmotic stress conditions. The exceptional induction level of slr0639 in response to salt stress (14.3-fold) makes its regulatory elements particularly valuable for synthetic biology applications requiring strong, stress-specific activation.

What experimental approaches are most effective for investigating the potential role of slr0639 in enhancing cyanobacterial tolerance to varying salinity conditions?

Investigating the role of slr0639 in enhancing cyanobacterial salinity tolerance requires multifaceted experimental approaches combining genetic, physiological, and biophysical methods:

  • Genetic manipulation studies:

    • Generate slr0639 knockout mutants in Synechocystis using homologous recombination

    • Create overexpression strains with slr0639 under constitutive or inducible promoters

    • Develop complementation strains with wild-type or modified slr0639 variants

    • Methodology details:

      • Use antibiotic resistance cassettes flanked by homology regions for targeted gene replacement

      • Confirm complete segregation through PCR and sequencing

      • Quantify expression levels using RT-qPCR and western blotting

  • Physiological characterization:

    • Compare growth rates of mutant and wild-type strains across a gradient of salinity levels

    • Measure photosynthetic efficiency using PAM fluorometry under salt stress conditions

    • Assess membrane integrity using fluorescent dyes like SYTOX Green

    • Monitor compatible solute accumulation using HPLC or NMR spectroscopy

    • Experimental design should include:

      • Acclimated cultures and sudden shock experiments

      • Multiple salt concentrations (e.g., 0.25M, 0.5M, 0.75M, 1.0M NaCl)

      • Time-course measurements to distinguish immediate vs. adaptive responses

  • Single-cell analysis techniques:

    • Employ microfluidic devices to apply controlled osmotic shifts while imaging cells

    • Use fluorescent reporters to monitor cell volume changes and recovery dynamics

    • Implement cell tracking algorithms to analyze population heterogeneity in stress response

    • This approach provides insights into cell-to-cell variability that population measurements miss

  • Omics integration:

    • Perform comparative transcriptomics and proteomics of wild-type vs. slr0639 mutants

    • Identify compensatory mechanisms activated when slr0639 is absent

    • Map the regulatory networks associated with slr0639 function

    • Methodology should include:

      • Multiple time points after salt shock (e.g., 30 min, 2 hr, 6 hr, 24 hr)

      • Both upshift and downshift salt stress experiments

      • Data integration using network analysis tools

  • Structural and functional membrane studies:

    • Employ patch-clamp electrophysiology on Synechocystis cells or spheroplasts

    • Compare channel activity in wild-type vs. modified strains

    • Use fluorescent membrane probes to assess membrane physical properties

    • Measure ion fluxes using ion-selective microelectrodes

  • Phenotypic microarray analysis:

    • Utilize Biolog or similar systems to assess growth across multiple stress conditions

    • Identify potential cross-protection between salt stress and other environmental challenges

    • Determine if slr0639 contributes to general stress tolerance beyond osmotic regulation

These comprehensive experimental approaches will provide mechanistic insights into how slr0639, which shows remarkable induction (14.3-fold) during salt stress , contributes to the well-established salt tolerance of Synechocystis sp. PCC 6803 and potentially inform strategies to enhance salinity tolerance in other cyanobacteria and plants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.