Recombinant Synechocystis sp. Uncharacterized protein sll1147 (sll1147)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if necessary. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request; however, additional fees apply. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
sll1147; Uncharacterized protein sll1147
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
sll1147
Target Protein Sequence
MTKTELLWPALITALATMLYLVLVINVGRARAKYGVMPPATTGNEDFERVLRVQYNTLEQ LAFFLPGLWLFAIYRDPTIAAILGAVWLLGRILYAWGYYQAAEKRMVGFALGSLSSMILV VGALLSILWQLRQLSQF
Uniprot No.

Target Background

Database Links
Protein Families
MAPEG family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the protein sll1147 in Synechocystis sp. PCC 6803?

Protein sll1147 is a MAPEG2-like protein (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) found in the model cyanobacterium Synechocystis PCC 6803. It functions as a glutathione-S-transferase-like protein involved primarily in stress response mechanisms. While the protein is dispensable for standard photoautotrophic growth conditions, in vivo analysis has demonstrated its significant role in resistance to temperature extremes (both heat and cold) and oxidative stress, particularly against agents that induce lipid peroxidation such as n-tert-butyl hydroperoxide (n-tBOOH) .

What cellular pathways involve protein sll1147?

Based on current research, sll1147 appears to be involved in stress response pathways, particularly those related to oxidative stress management. As a MAPEG-type protein, it likely participates in glutathione-dependent detoxification processes that protect cyanobacterial cells from reactive oxygen species (ROS) generated during photosynthesis. The protein's involvement in temperature stress resistance suggests it may also play a role in maintaining membrane integrity or protein stability under varying environmental conditions .

How does the expression profile of sll1147 compare to other genes in the Synechocystis genome?

While specific expression data for sll1147 is limited in the provided search results, general genomic analysis of Synechocystis indicates that only about 9.5% of genes fall into the highly expressed category. Genes with higher predicted expression levels often display strong compositional bias in terms of codon usage and tend to utilize a narrow set of preferred codons . Studies of the Synechocystis proteome have identified 1528 proteins, with approximately 24.5% being membrane integral proteins . To determine if sll1147 belongs to the highly expressed category, researchers should analyze its Relative Codon Usage Bias Score (RCBS), which has shown better correlation with experimental expression data than other indices such as E(g) and CAI .

What proteomics approaches are most effective for studying sll1147 and its interactions?

Based on successful proteome analysis of Synechocystis, the following methodology is recommended for studying sll1147 and its interaction partners:

  • Culture preparation: Grow Synechocystis cultures under both standard and stress conditions (heat, cold, oxidative stress)

  • Protein isolation: Purify and concentrate protein samples using SDS gel focusing to create a single focused band between stacking and separating gel

  • Tryptic digestion: Digest protein samples with trypsin

  • LC-MS analysis: Perform untargeted mass spectrometric approach with at least three technical replicates per biological replicate

  • Peptide identification: Use algorithms such as Sequest with filter criteria set to achieve a false positive rate below 5%

This approach has successfully identified 1528 proteins in Synechocystis, including 374 membrane integral proteins, and should be effective for studying sll1147 and its potential interaction partners .

What are the optimal conditions for expressing recombinant sll1147 protein?

For optimal expression of recombinant sll1147, researchers should consider the following methodological approach:

  • Expression system selection: Given sll1147's role as a membrane-associated protein, E. coli BL21(DE3) with pET vector systems containing a fusion tag (His6, GST, or MBP) is recommended for initial expression trials

  • Expression optimization matrix:

ParameterTest ConditionsOptimal Range
Temperature16°C, 25°C, 37°C16-25°C for membrane proteins
Induction time4h, 8h, 16hOften 16h at lower temperatures
IPTG concentration0.1mM, 0.5mM, 1.0mM0.1-0.5mM typically
MediaLB, TB, 2xYT, M9TB or 2xYT for higher yields
AdditivesNone, 1% glucose, 5% glycerolVariable by construct
  • Solubility enhancement: Addition of mild detergents (0.1% DDM, 1% CHAPS) during lysis may improve solubility of this membrane-associated protein

  • Expression verification: Western blot analysis using anti-His tag antibodies (or appropriate tag)

Research should be guided by the finding that highly expressed genes in Synechocystis often display strong codon usage bias , which may necessitate codon optimization if expressing in heterologous systems.

What purification strategy yields the highest purity and activity for recombinant sll1147?

For optimal purification of recombinant sll1147, the following stepwise protocol is recommended:

  • Initial capture:

    • For His-tagged constructs: IMAC using Ni-NTA resin with imidazole gradient elution

    • For GST-tagged constructs: Glutathione-agarose affinity chromatography

  • Intermediate purification:

    • Ion exchange chromatography (test both anion and cation exchange)

    • Consider detergent exchange if initial solubilization used harsh detergents

  • Polishing step:

    • Size exclusion chromatography in appropriate buffer with mild detergent

  • Quality assessment matrix:

Quality ParameterMethodAcceptance Criteria
PuritySDS-PAGE>95% single band
IdentityMass spectrometryMatches theoretical mass
ActivityGST activity assayDetectable activity above background
HomogeneityDynamic light scatteringMonodisperse population
Structural integrityCircular dichroismSecondary structure content
  • Storage optimization: Test stability in various buffers with and without glycerol at 4°C, -20°C, and -80°C

Since sll1147 is involved in stress responses related to temperature and oxidative stress , maintaining reducing conditions during purification (addition of DTT or β-mercaptoethanol) may be critical for preserving functional activity.

What functional assays are most appropriate for characterizing sll1147 activity?

Given sll1147's classification as a MAPEG-type glutathione-S-transferase-like protein involved in stress responses , the following functional assays are recommended:

  • Glutathione-S-transferase activity assay:

    • Substrate: 1-chloro-2,4-dinitrobenzene (CDNB)

    • Measure conjugation rate spectrophotometrically at 340nm

    • Compare activity with and without oxidative stressors

  • Lipid peroxidation protection assay:

    • Measure protection against n-tBOOH-induced lipid peroxidation

    • Quantify malondialdehyde (MDA) or other lipid peroxidation products

    • Compare wild-type vs. sll1147 knockout strains

  • Thermal stability assessment:

    • Differential scanning fluorimetry to determine protein stability

    • Compare stability at different temperatures (relevant to heat/cold resistance function)

    • Assess stability in presence/absence of glutathione and substrate analogs

  • Membrane association analysis:

    • Assess membrane localization using fractionation studies

    • Determine topology using protease protection assays

    • Identify critical residues for membrane association through site-directed mutagenesis

These assays directly address the known functions of sll1147 in stress response, particularly its role in resistance to temperature extremes and oxidative stress .

How can researchers effectively measure sll1147's impact on cellular stress responses?

To comprehensively assess sll1147's impact on cellular stress responses, researchers should implement the following experimental approach:

  • Stress response comparison matrix:

Stress TypeMeasurement ParametersExpected Difference (WT vs. Knockout)
Heat (42°C)Growth rate, viabilityHigher survival in WT after exposure
Cold (15°C)Membrane fluidity, metabolic activityBetter adaptation in WT
Oxidative (n-tBOOH)ROS levels, lipid peroxidationLower peroxidation in WT
Combined stressesAll above parametersSynergistic effects expected
  • Temporal analysis:

    • Measure stress responses at multiple time points (0h, 1h, 3h, 6h, 24h)

    • Compare immediate vs. adaptive responses in WT and knockout strains

  • Dose-response assessment:

    • Subject cultures to increasing concentrations of stressors

    • Determine EC50 values for each stressor in WT vs. knockout

  • Global response analysis:

    • Transcriptomic profiling (RNA-seq) under stress conditions

    • Proteomic analysis focused on stress response pathways

    • Metabolomic analysis emphasizing glutathione and related metabolites

This comprehensive approach will provide detailed insights into how sll1147 contributes to various stress response mechanisms in Synechocystis, particularly regarding its documented roles in temperature and oxidative stress resistance .

What structural features of sll1147 are critical for its function in stress response?

While detailed structural information about sll1147 is limited in the available search results, as a MAPEG-type protein, certain structural features can be predicted to be critical for its function:

  • Transmembrane domains:

    • MAPEG proteins typically contain 4 transmembrane segments

    • These domains are likely essential for membrane association and proper orientation

  • Glutathione binding site:

    • As a glutathione-S-transferase-like protein, sll1147 likely contains a conserved glutathione binding motif

    • Site-directed mutagenesis of predicted glutathione-binding residues would confirm their importance

  • Active site residues:

    • Catalytic residues involved in the conjugation of glutathione to substrates

    • Comparative analysis with other MAPEG proteins can help identify these residues

  • Stress-sensing regions:

    • Domains that respond to temperature changes or oxidative stress

    • May include cysteine residues that act as redox sensors

Researchers should employ homology modeling based on known MAPEG protein structures to predict these features in sll1147, followed by experimental validation through site-directed mutagenesis and functional assays.

How do post-translational modifications affect sll1147 function under different stress conditions?

To investigate the role of post-translational modifications (PTMs) in regulating sll1147 function under different stress conditions, researchers should implement the following experimental approach:

  • PTM identification: Use advanced mass spectrometry techniques to identify potential modifications under different stress conditions:

    • Phosphorylation (stress signaling)

    • Oxidation (response to oxidative stress)

    • S-glutathionylation (common in redox-sensitive proteins)

  • PTM site mapping: Determine the specific residues modified under each condition and create a modification map of sll1147

  • Functional impact analysis:

    • Generate site-specific mutants (e.g., phospho-mimetic and phospho-null)

    • Test these mutants using the functional assays described in section 5.1

    • Compare activity under different stress conditions

  • PTM dynamics:

    • Monitor temporal changes in modifications during stress application and recovery

    • Identify enzymes responsible for adding/removing these modifications

  • Physiological significance:

    • Correlate modification patterns with stress resistance phenotypes

    • Determine if modifications are necessary and/or sufficient for stress protection

This comprehensive approach will provide insights into how post-translational modifications might regulate sll1147's documented functions in temperature and oxidative stress resistance .

How conserved is sll1147 across different cyanobacterial species and what does this suggest about its evolutionary importance?

To assess the evolutionary conservation and importance of sll1147, researchers should conduct a comprehensive comparative analysis:

  • Sequence conservation analysis:

    • Perform BLAST searches against cyanobacterial genomes

    • Calculate sequence identity/similarity percentages

    • Identify highly conserved domains and residues

  • Phylogenetic analysis:

    • Construct phylogenetic trees of sll1147 homologs

    • Compare with species phylogeny to identify potential horizontal gene transfer events

    • Determine if sll1147 evolved from a common ancestor of MAPEG proteins

  • Conservation pattern table:

Cyanobacterial GroupConservation LevelNotable Adaptations
Unicellular non-N2-fixing (e.g., Synechocystis)Reference (100%)Standard MAPEG features
Unicellular N2-fixing (e.g., Cyanothece)Predicted highPossible additional domains
Filamentous non-heterocystousVariableEnvironment-specific adaptations
Filamentous heterocystousVariablePossible specialization in heterocysts
Thermophilic cyanobacteriaModified versionsHeat-stability adaptations
  • Functional conservation testing:

    • Express homologs from different species in sll1147 knockout

    • Test complementation of stress response phenotypes

    • Identify species-specific functional differences

What insights can be gained from comparing sll1147 to similar proteins in other organisms beyond cyanobacteria?

Expanding the comparative analysis beyond cyanobacteria can provide valuable insights into the broader evolutionary context and functional diversification of MAPEG-type proteins:

  • Cross-kingdom comparison:

    • Identify and align homologs from plants, algae, and other bacteria

    • Determine when these proteins first appeared evolutionarily

    • Identify kingdom-specific adaptations

  • Functional adaptation analysis:

    • Compare substrate specificity across different organisms

    • Identify adaptations related to specific ecological niches

    • Determine if similar stress response roles exist in distant homologs

  • Structural comparison:

    • Analyze conservation of key structural elements

    • Identify novel domains acquired during evolution

    • Compare membrane association mechanisms

  • Cross-system functional conservation:

    • Test if homologs from other systems can complement sll1147 knockout

    • Determine if sll1147 can function in heterologous systems

    • Identify critical residues required for cross-system functionality

This broader comparative analysis will place sll1147 in its proper evolutionary context and may reveal unexpected functional connections to MAPEG-type proteins in other organisms, potentially opening new research directions beyond cyanobacterial stress responses .

What are the most promising approaches for elucidating the detailed molecular mechanism of sll1147 in stress protection?

To fully elucidate the molecular mechanisms by which sll1147 confers protection against temperature extremes and oxidative stress , researchers should pursue the following integrated approaches:

  • High-resolution structural analysis:

    • Cryo-EM or X-ray crystallography of sll1147 in different functional states

    • Structural comparisons with and without glutathione/substrates

    • Membrane-protein interaction studies using advanced biophysical techniques

  • Systems biology approach:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Network analysis to place sll1147 in broader stress response pathways

    • Identification of critical nodes in the network that interface with sll1147

  • Single-cell analysis:

    • Study cell-to-cell variability in sll1147 expression during stress

    • Correlate expression levels with cellular outcomes

    • Identify potential subpopulation stress response strategies

  • In vivo dynamics:

    • Real-time monitoring of sll1147 localization during stress using fluorescent tags

    • FRET-based sensors to detect conformational changes upon stress

    • Interaction mapping using proximity labeling approaches

These complementary approaches will provide a comprehensive understanding of how sll1147 functions at the molecular level to protect Synechocystis cells against various stressors.

How might the characterization of sll1147 inform biotechnological applications in stress-resistant cyanobacterial strains?

Understanding sll1147's role in stress protection could inform the development of stress-resistant cyanobacterial strains for various biotechnological applications:

  • Strain engineering opportunities:

    • Overexpression of sll1147 to enhance stress tolerance

    • Expression of sll1147 variants optimized for specific stressors

    • Co-expression with complementary stress protection systems

  • Potential biotechnological applications:

Application AreaRelevance of sll1147Engineering Approach
Biofuel productionEnhanced tolerance to production conditionsControlled overexpression
Environmental bioremediationSurvival in contaminated environmentsStress-inducible expression
PhotobioreactorsResilience to temperature fluctuationsTemperature-responsive regulation
Protein/metabolite productionStable production under stressIntegration with production pathways
  • Predictive modeling:

    • Develop models to predict cellular responses to stress with modified sll1147

    • Optimize expression levels for different applications

    • Design synthetic stress response circuits incorporating sll1147

  • Translational research opportunities:

    • Apply insights from sll1147 to enhance stress tolerance in other organisms

    • Develop biosensors based on sll1147 stress-sensing mechanisms

    • Explore medical applications of stress protection mechanisms

This application-focused research would translate the fundamental characterization of sll1147 into practical biotechnological solutions, particularly for applications requiring robust cyanobacterial strains capable of withstanding environmental stressors .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.