Recombinant Synechocystis sp. Uncharacterized protein slr0014 (slr0014)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and storing in aliquots at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
slr0014; Uncharacterized protein slr0014
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-234
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
slr0014
Target Protein Sequence
MEWNESLLRLTVAFVLGSTLGIERQWRQRMAGLRTNTLVAIGAALFVIVSVLTNHDSSPT RIPAQIVSGIGFLAGGVILKEGLTVKGLNTAATLWCSAAVGTLCGQGLFSEAVLGSMMVL VANIALRPLSTFINHQPMHSTELECHYLCHLVCRGDEEANVRRILLDSLAEIKNIKLRSL RSHDLDEFNHFVEVEAAIICTARKDKFLEAVISKLSLNPSVKSVSWQALEQESG
Uniprot No.

Target Background

Database Links
Protein Families
MgtC/SapB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the predicted structure and function of the uncharacterized protein slr0014 in Synechocystis sp. PCC 6803?

While slr0014 remains uncharacterized, researchers can employ bioinformatic approaches similar to those used for other Synechocystis proteins to predict structure and function. Just as researchers predicted a beta-helical structure for certain proteins despite low sequence identity with known structures , sequence analysis of slr0014 can be performed using tools such as BLAST, Pfam, and structure prediction algorithms. Comparative analysis with characterized proteins like Slr0058, which shows similarities with regulatory phasins , may provide initial insights into potential functions.

How can I effectively express recombinant slr0014 for functional studies?

For optimal expression of recombinant slr0014, consider the following methodological approach:

  • Vector selection: Choose an appropriate expression vector system compatible with cyanobacterial proteins.

  • Promoter selection: For Synechocystis proteins, using native promoters can help maintain physiological expression levels as demonstrated in knockout studies where researchers placed native promoters downstream of antibiotic cassettes to prevent unintended effects on downstream genes .

  • Expression conditions: Culture conditions significantly impact protein expression. Based on protocols for other Synechocystis proteins, standard growth conditions include BG-11 medium at 30°C with light intensity of 100 μE × m⁻² × s⁻¹ and 3% CO₂ .

  • Purification strategy: Design a purification scheme based on predicted properties of slr0014.

What are the best growth conditions for Synechocystis sp. PCC 6803 when studying slr0014 expression?

Optimal growth conditions for Synechocystis sp. PCC 6803 typically include:

  • Medium: Standard BG-11 medium in sterile glass flasks on a table-top orbital shaker with cotton caps to allow proper CO₂ incorporation .

  • Temperature: 30°C is standard, though temperature shifts can be used to study stress responses .

  • Agitation: 100 rpm is typically used for adequate mixing .

  • Light conditions: 100 μE × m⁻² × s⁻¹ is standard for photosynthetic growth .

  • CO₂ concentration: 3% CO₂ is commonly used for optimal growth .

These conditions provide a baseline for studying slr0014 under standard physiological conditions before exploring regulatory changes under various stressors.

How can I determine if slr0014 is essential for photoautotrophic growth similar to other uncharacterized proteins in Synechocystis?

To determine essentiality of slr0014 for photoautotrophic growth:

  • Generate knockout mutants using methods like those used for other Synechocystis genes:

    • Construct a plasmid for double homologous recombination where slr0014 is replaced by an antibiotic resistance cassette

    • Ensure the native promoter is preserved downstream of the cassette to prevent polar effects

    • Transform the construct into Synechocystis using natural transformation

    • Select transformants on antibiotic-containing photoheterotrophic medium

    • Confirm complete segregation through multiple transfers

  • Phenotypic analysis:

    • Compare growth rates under both photoheterotrophic and photoautotrophic conditions at 30°C with light intensity of 20 μmol photons m⁻² s⁻¹

    • Monitor growth for at least 10 days as done for other mutants

    • Measure oxygen evolution using oxygen polarography with 1 mM bicarbonate as electron acceptor

    • Analyze changes in pigmentation and spectral characteristics

  • Complementation studies:

    • Reintroduce slr0014 to confirm phenotype reversal and rule out polar effects

This approach follows the methodology that successfully identified other novel proteins required for optimal photoautotrophic growth in Synechocystis .

What transcriptomic approaches can reveal the expression patterns of slr0014 under various stress conditions?

For transcriptomic analysis of slr0014 expression under stress conditions:

  • Stress application protocols:

    • High light stress: Increase light intensity from 100 to 300 μE × m⁻² × s⁻¹

    • Dark stress: Transfer cultures to complete darkness

    • Nitrogen starvation: Wash cells and resuspend in nitrogen-free BG-11

    • Temperature stress: Shift cultures from 30°C to 20°C

    • Carbon starvation: Close CO₂ circulation and allow culture to continue growth

  • RNA isolation and sequencing:

    • Collect 25 ml samples at 1h and 24h after stress application

    • Deplete ribosomal RNA using MicrobExpress

    • Treat with Terminator 5'-Phosphate Dependent Exonuclease

    • Remove pyrophosphate groups from 5' end of mRNA using RppH

    • Ligate RNA adapter to 5' end using T4 RNA Ligase I

    • Synthesize cDNA and perform PCR amplification

    • Size-select products between 300-700 bp

  • Data analysis:

    • Map high-quality reads to the reference genome

    • Quantify expression using appropriate statistical methods

    • Compare expression patterns with other genes of known function

    • Apply gene co-expression analysis to predict function

How can protein localization studies help characterize slr0014 function?

Protein localization studies can provide critical insights into slr0014 function:

  • GFP-tagging approach:

    • Engineer a GFP-slr0014 fusion construct

    • Transform into Synechocystis and verify expression

    • Analyze localization patterns under various growth conditions

    • Compare with localization patterns of characterized proteins like Slr0058, which forms distinct foci during vegetative growth despite not co-localizing with PHB granules during nitrogen starvation

  • Subcellular fractionation:

    • Separate membrane, cytosolic, and other cellular fractions

    • Use Western blotting to detect slr0014 in different fractions

    • Compare localization with other proteins of known subcellular distribution

  • Immunogold electron microscopy:

    • Generate antibodies against recombinant slr0014

    • Use for immunogold labeling and transmission electron microscopy

    • Examine potential association with specific cellular structures

These approaches can reveal whether slr0014 associates with specific cellular compartments or macromolecular structures, providing clues to its function.

What genetic manipulation techniques are most effective for creating slr0014 knockout mutants in Synechocystis?

For creating slr0014 knockout mutants in Synechocystis:

  • Construct design:

    • Design a knockout construct with an antibiotic resistance cassette flanked by ~500-1000 bp homologous regions upstream and downstream of slr0014

    • Include the native promoter downstream of the antibiotic cassette to prevent polar effects on downstream genes

    • Gibson Assembly has proven effective for constructing such plasmids

  • Transformation:

    • Exploit the natural competence of Synechocystis for DNA uptake

    • Verify successful transformation through colony PCR and sequencing

    • Ensure complete segregation through multiple transfers on selective media

  • Verification methods:

    • Southern blot analysis to confirm single transposon insertion

    • PCR verification of gene replacement

    • Whole genome sequencing to rule out secondary mutations

This approach has successfully generated knockouts for studying other Synechocystis proteins like Slr0058 and Slr0060 .

What proteomics techniques are most informative for studying slr0014 interactions and modifications?

For comprehensive proteomic analysis of slr0014:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged slr0014 or generate specific antibodies

    • Perform Co-IP followed by mass spectrometry

    • Identify interaction partners that may suggest functional roles

  • Cross-linking mass spectrometry:

    • Apply protein cross-linkers to capture transient interactions

    • Digest and analyze by LC-MS/MS

    • Map interaction interfaces at amino acid resolution

  • Post-translational modification analysis:

    • Use phosphoproteomic approaches to identify potential phosphorylation sites

    • Analyze other modifications (acetylation, methylation, etc.)

    • Correlate modifications with cellular conditions

  • Comparative abundance analysis:

    • Analyze protein abundance across growth conditions using quantitative proteomics

    • Identify conditions where slr0014 is most abundant, similar to approaches that identified abundant proteins in planktonic cultures and biofilms

What are the recommended protocols for analyzing slr0014 expression changes during nitrogen starvation?

For analyzing slr0014 expression during nitrogen starvation:

  • Experimental setup:

    • Grow Synechocystis cultures to mid-logarithmic phase in BG-11 medium

    • Harvest cells by centrifugation and wash twice with nitrogen-free BG-11

    • Resuspend cells in nitrogen-free BG-11 at equivalent optical density

    • Sample at multiple timepoints (0h, 6h, 12h, 24h, 48h, 1 week)

  • Expression analysis options:

    • RT-qPCR: Design specific primers for slr0014 and appropriate reference genes

    • Western blotting: Use specific antibodies against slr0014

    • RNA-seq: Apply full transcriptome analysis to capture global expression changes

  • Physiological correlation:

    • Monitor changes in PHB accumulation using Nile Red staining and fluorescence microscopy

    • Measure glycogen levels as they typically increase during initial chlorosis

    • Track optical density (OD750) to assess cell viability during prolonged nitrogen starvation

This protocol is based on successful approaches used to study other proteins during nitrogen starvation in Synechocystis .

How can I predict the functional role of slr0014 using gene co-expression network analysis?

To predict slr0014 function using co-expression analysis:

  • Data collection:

    • Compile transcriptomic data from various growth conditions and stress responses

    • Include data from wild-type and relevant mutant strains

    • Integrate publicly available datasets with your experimental data

  • Network construction:

    • Calculate pairwise gene expression correlations

    • Apply appropriate thresholds to define significant co-expression

    • Construct gene co-expression networks

  • Functional prediction:

    • Identify genes with expression patterns most similar to slr0014

    • Analyze functional enrichment in slr0014's co-expression cluster

    • Predict association with biochemical pathways by linking to well-characterized genes

    • Consider proximity in the genome, as genes in operons often have related functions

This approach has successfully improved functional annotation of genes and pathways in cyanobacteria .

How should I interpret differences between in silico predictions and experimental data for slr0014?

When facing discrepancies between computational predictions and experimental results:

  • Systematic evaluation:

    • Review prediction algorithm limitations and assumptions

    • Consider whether experimental conditions might affect protein behavior

    • Examine whether post-translational modifications might explain differences

    • Assess if protein-protein interactions could alter expected function

  • Resolution strategies:

    • Design targeted experiments to test specific hypotheses explaining discrepancies

    • Apply multiple prediction methods and assess consensus

    • Consider structural biology approaches to directly determine protein structure

    • Examine homologs in related species for conservation patterns

  • Reporting guidelines:

    • Document both computational and experimental approaches thoroughly

    • Present conflicting data transparently with potential explanations

    • Consider evolutionary context that might explain functional divergence

What statistical approaches are appropriate for analyzing slr0014 expression data across multiple stress conditions?

For rigorous statistical analysis of slr0014 expression data:

  • Preprocessing and normalization:

    • Apply appropriate normalization methods for the specific platform used

    • Evaluate data quality and remove outliers

    • Transform data if necessary to meet statistical assumptions

  • Statistical testing:

    • For pairwise comparisons: t-tests with appropriate multiple testing correction

    • For multiple conditions: ANOVA followed by post-hoc tests

    • For time series: repeated measures ANOVA or mixed effects models

    • For complex designs: consider linear models with interaction terms

  • Advanced analyses:

    • Principal component analysis to identify major sources of variation

    • Clustering approaches to group conditions with similar expression patterns

    • Time-series analysis for temporal expression patterns

    • Meta-analysis when combining multiple datasets

  • Visualization methods:

    • Heat maps for comparing expression across multiple conditions

    • Line graphs for temporal patterns

    • Volcano plots for highlighting significant changes

    • Network visualizations for co-expression relationships

How can studying slr0014 contribute to our understanding of cyanobacterial stress responses?

Investigating slr0014 can enhance our understanding of cyanobacterial stress responses through:

  • Comparative analysis with stress-responsive genes:

    • Determine if slr0014 expression changes under stresses like nitrogen starvation, carbon limitation, temperature shifts, or high light

    • Compare expression patterns with known stress-responsive genes

    • Assess whether Δslr0014 mutants show altered stress tolerance

  • Potential regulatory functions:

    • Investigate if slr0014 has regulatory roles similar to Slr0058, which controls PHB granule formation during nitrogen starvation

    • Examine if slr0014 affects expression of other genes during stress responses

    • Determine if slr0014 is part of known stress response regulatory networks

  • Metabolic integration:

    • Assess if slr0014 affects metabolic pathways that are modulated during stress

    • Investigate potential roles in carbon or nitrogen metabolism regulation

    • Consider if slr0014 could be involved in photorespiratory processes or carbon-concentrating mechanisms similar to other proteins required for optimal photoautotrophy

What approaches can differentiate the role of slr0014 from functionally redundant proteins in Synechocystis?

To differentiate slr0014's role from potentially redundant proteins:

  • Multiple knockout analysis:

    • Create single and combined knockouts of slr0014 and suspected redundant genes

    • Compare phenotypes between single and multiple mutants

    • Look for synergistic effects indicating functional redundancy

    • Consider that Synechocystis often possesses homologous enzyme sets for central reactions, as observed with GlgA1/2, GlgP1/2, and GlgX1/2

  • Domain-specific functional analysis:

    • Identify unique domains or structural features in slr0014

    • Create chimeric proteins to test domain-specific functions

    • Use site-directed mutagenesis to target unique residues

  • Condition-specific expression analysis:

    • Investigate whether slr0014 and potential homologs show different expression patterns under specific conditions

    • Look for condition-specific phenotypes in knockout mutants

    • Test complementation abilities under various conditions

This approach addresses the challenge of functional redundancy, which has complicated the characterization of other proteins like Slr0060 .

How can computational models integrate slr0014 into our understanding of Synechocystis metabolism?

For integrating slr0014 into computational models of Synechocystis metabolism:

  • Model expansion approach:

    • Add slr0014 to existing genome-scale metabolic models

    • Integrate expression data to constrain flux predictions

    • Perform sensitivity analysis to identify conditions where slr0014 may be most important

    • Compare model predictions with experimental phenotypes of knockout mutants

  • Flux balance analysis:

    • Use experimental data from wild-type and Δslr0014 strains to constrain flux distributions

    • Identify metabolic pathways most affected by slr0014 deletion

    • Consider approaches similar to metabolic flux analysis of 13C-labeled glucose that revealed unexpected metabolic pathways

  • Regulatory network integration:

    • Incorporate slr0014 into transcriptional regulatory networks

    • Model how slr0014 expression changes affect downstream processes

    • Predict system-level responses to environmental perturbations

This integrative approach can place slr0014 within the broader context of cyanobacterial metabolism and stress responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.