Recombinant Synechocystis sp. Uncharacterized protein slr0269 (slr0269)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Synechocystis sp. uncharacterized protein slr0269 (slr0269) is a protein derived from the cyanobacterium Synechocystis sp. PCC 6803. It is also referred to as uncharacterized protein slr0269.

PropertyDescription
Synonymsslr0269, Uncharacterized protein slr0269
SourceSynechocystis sp. (strain PCC 6803 / Kazusa)
Subcellular LocationCell membrane; Multi-pass membrane protein
Database LinksKEGG: syn:slr0269; STRING: 1148.SYNGTS_1376
Purity>85% (SDS-PAGE)
FormLyophilized powder
Buffer BeforeTris/PBS-based buffer, 6% Trehalose
Protein LengthPartial
Storage ConditionStore at -20°C/-80°C upon receipt. Aliquot the protein to prevent degradation and avoid repeated freeze-thaw cycles.
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% glycerol for long-term storage.

Availability and Sourcing

Recombinant Synechocystis sp. uncharacterized protein slr0269 is available for purchase from The Biotek. It can be produced in various expression systems, including yeast, E. coli, baculovirus, and mammalian cells. The protein is shipped with ice packs, with the option for dry ice shipping available for an additional fee.

Function and Characteristics

The slr0269 protein is annotated as an "uncharacterized protein," meaning its specific function has not been definitively determined through experimentation. Bioinformatic analyses provide some clues:

  • Subcellular Localization: It is predicted to be located in the cell membrane and is likely a multi-pass membrane protein.

  • Homology: Database searches show some degree of similarity to other proteins, which may provide functional hints, although these relationships require experimental validation .

  • Protein Interactions: Large-scale protein-protein interaction studies in Synechocystis are useful to provide information regarding the function of uncharacterized proteins .

Experimental Uses

While the specific function of slr0269 remains unclear, recombinant forms of the protein are useful for:

  • Antibody Production: Recombinant proteins can be used as antigens to generate specific antibodies for detection and localization studies.

  • Protein-Protein Interaction Studies: The recombinant protein can be used as bait to identify interacting partners, providing insights into its potential function .

  • Structural Studies: Recombinant production is a prerequisite for determining the three-dimensional structure of the protein, which can provide valuable information about its mechanism of action.

Related Research

Other studies on Synechocystis sp. PCC 6803 have investigated various aspects of its physiology and molecular biology. For example, studies have focused on:

  • Outer Membrane Permeability: Determination of the outer membrane permeability of Synechocystis sp. PCC 6803 using small carbohydrates, amino acids, and inorganic ions as permeation probes .

  • Light Quality Acclimation: Comprehensive study of light quality acclimation in Synechocystis sp. PCC 6803 through the whole range of photosynthetically active radiation .

  • CRISPR interference screens: Large gene repression library consisting of more than 20,000 individual mutants in 11 different conditions to screen for growth-robustness tradeoffs in Synechocystis .

  • Secreted Proteins: Investigating the spectrum of secreted proteins in the cyanobacterium Synechocystis, and identified these proteins by amino-terminal sequencing .

  • Slr0058 Protein: Showing that Slr0058 plays a role in PHB granule formation and controls it surface-to-volume ratio .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with blue ice packs by default. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
slr0269; Uncharacterized protein slr0269
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
slr0269
Target Protein Sequence
MPSTFSQPSPSNALVNDRRDVFPLSPLIKITLVNLYLALTVPLPILAQLTQGNALLTLLL TVGLMGGLVALVAALAEQVVLNGEGIAVRYPRWVPKFFRSGWQLSWADVTALKCRTTGQG GLVYYFLTESKDRAYLLPMRVAGFNRLTQLVSDHTGIDTQDVRPLSQPWMYLLLLLFTFL LWGSQLAIVLLLWSSPPLA
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What approaches can be used to determine the potential function of slr0269?

To determine the function of uncharacterized proteins like slr0269 in Synechocystis, researchers should implement a multi-faceted approach:

  • Transcriptomic analysis: Generate genome-wide maps of transcriptional start sites under different conditions to identify when and how the gene is expressed. RNA-seq and differential RNA-seq (dRNA-seq) analyses can provide insights into gene expression changes and promoter activity .

  • Response to environmental stimuli: Examine expression patterns under different environmental conditions (carbon depletion, nitrogen depletion, phosphate depletion, iron stress, etc.) to identify potential functional associations .

  • Operon structure analysis: Determine if slr0269 is part of an operon, which can provide clues about its function based on known functions of other genes in the same transcriptional unit .

  • Comparative genomics: Analyze the presence of homologous proteins across other cyanobacterial species to infer evolutionary conservation and potential function .

How can researchers accurately assess the expression levels of slr0269?

For accurate assessment of slr0269 expression levels, researchers should:

  • Employ multiple reference genes: When performing qRT-PCR, use multiple stable reference genes to normalize expression data.

  • Consider environmental conditions: Based on transcriptomic studies, expression of genes in Synechocystis can vary significantly under different environmental conditions. Researchers should test expression under relevant conditions including standard growth, carbon depletion, nitrogen depletion, phosphate depletion, iron stress, and various light conditions .

  • Use transcriptomic mapping: Utilize dRNA-seq data to identify the precise transcriptional start site and expression patterns at single-nucleotide resolution .

  • Account for 5' and 3' UTRs: Consider the untranslated regions when designing primers for expression analysis, as these regions may contain regulatory elements that affect expression .

What CRISPR/Cas9 strategies are most effective for studying slr0269 in polyploid Synechocystis?

For effective CRISPR/Cas9-based studies of slr0269 in polyploid Synechocystis:

  • sgRNA design considerations:

    • Select a target site with an NGG PAM, which has been reported to hold the highest activity compared to other PAMs .

    • Design the protospacer region carefully to avoid off-target effects, as specificity is not always ensured .

    • Consider using empirical methods to identify and design effective sgRNAs, similar to those used for targeting other genes in Synechocystis .

  • Donor DNA design:

    • Include appropriate homology arms (~200-400bp) upstream and downstream of the cut site .

    • Omit the PAM sequence from inclusion in the homology arms to prevent unintended and continuous cleavage from Cas9 at the target site .

    • Consider using both markerless and selection marker-bearing donor DNA depending on experimental goals .

  • Induction and selection strategies:

    • For inducible systems, use anhydrotetracycline (aTc) at appropriate concentrations (200-400 ng/mL) based on experimental needs .

    • Consider light conditions (white vs. red light) which may affect the efficiency of the system .

  • Segregation analysis:

    • Perform thorough segregation analysis using PCR to ensure complete mutation of all genome copies in the polyploid organism .

    • Design segregation primers that amplify across the modified region to distinguish between wild-type and mutant copies .

How can researchers differentiate between direct and indirect effects when studying slr0269 function?

To differentiate between direct and indirect effects in slr0269 functional studies:

  • Employ temporal studies: Track changes immediately following induction or repression of slr0269 to identify early (likely direct) versus late (likely indirect) effects.

  • Use complementation studies: Create knock-out strains followed by controlled re-introduction of slr0269 to observe which phenotypes are directly rescued.

  • Perform protein-protein interaction studies: Use techniques such as co-immunoprecipitation, yeast two-hybrid, or proximal labeling approaches to identify direct interaction partners.

  • Cross-reference with transcriptomic data: Compare changes induced by slr0269 manipulation with known response patterns to various stimuli documented in transcriptomic datasets .

  • Create conditional expression systems: Develop systems that allow for rapid induction or repression of slr0269 to better distinguish direct from secondary effects.

What in silico approaches can predict structure-function relationships for slr0269?

For predicting structure-function relationships of uncharacterized proteins like slr0269:

  • Fitness landscape modeling: Apply statistical learning frameworks similar to those used for DHFR to model the relationship between protein sequence, structure, and function .

  • Adaptive walk simulations: Use computational methods to predict the effects of sequential mutations and identify potential evolutionary trajectories .

  • Structure prediction: Utilize AlphaFold or RoseTTAFold to generate structural models, followed by analysis of conserved domains and potential binding sites.

  • Molecular dynamics simulations: Perform simulations to understand protein flexibility, potential conformational changes, and interaction with other molecules.

  • Evolutionary conservation analysis: Identify highly conserved residues across cyanobacterial homologs, which often indicate functionally important sites.

What are the key considerations for designing knock-out or knock-in experiments for slr0269?

When designing genetic modification experiments for slr0269:

Design AspectKey ConsiderationsImplementation Notes
Target site selectionChoose regions that minimize off-target effectsAnalyze genome for similar sequences
sgRNA designSelect effective protospacer sequencesConsider GC content and secondary structure
Homology arm design~200-400bp homology armsOmit PAM sequence from homology arms
Selection strategyAntibiotic markers vs. markerless approachesBalance between ease of selection and potential interference
Segregation verificationPCR-based confirmation of complete genome modificationDesign primers to distinguish wild-type and modified loci
Induction conditionsOptimize aTc concentration and light conditionsTest both 200 ng/mL and 400 ng/mL aTc under different light conditions
Phenotypic validationComprehensive characterization under various conditionsTest growth, metabolic outputs, stress responses

Researchers must account for the polyploid nature of Synechocystis, which requires careful verification of complete segregation of the desired modification across all genome copies .

How should experiments be designed to study slr0269 expression and regulation under different environmental conditions?

To effectively study slr0269 expression and regulation:

  • Condition selection: Based on transcriptomic studies, test expression under multiple relevant conditions including:

    • Standard growth conditions

    • Carbon depletion (which may activate carbon-stress induced regulons)

    • Nitrogen depletion (associated with nitrogen-stress induced regulons)

    • Phosphate depletion

    • Iron stress conditions

    • Different light intensities and qualities

  • Time-course analysis: Sample at multiple time points after shifting to stress conditions to capture both immediate and adaptive responses.

  • Promoter analysis: Characterize the promoter region at single-nucleotide resolution to identify regulatory elements and potential transcription factor binding sites .

  • 5' and 3' UTR characterization: Map untranslated regions which may contain regulatory elements affecting translation efficiency or mRNA stability .

  • Regulon identification: Determine if slr0269 belongs to a specific regulon by comparing its expression pattern with other genes showing similar responses to environmental stimuli .

How should researchers interpret contradictory data regarding slr0269 function?

When encountering contradictory data about slr0269 function:

  • Evaluate experimental conditions: Minor differences in growth conditions, strain backgrounds, or experimental procedures can significantly impact results in cyanobacterial studies.

  • Consider genetic context: The polyploid nature of Synechocystis may lead to partial segregation of mutations, resulting in mixed phenotypes .

  • Assess functional redundancy: Synechocystis may have redundant systems that compensate for slr0269 disruption under certain conditions.

  • Validate key findings with multiple approaches: Confirm important results using orthogonal experimental methods.

  • Examine temporal dynamics: Contradictory findings may result from observing different time points in adaptive responses.

  • Integrate with systems-level data: Place conflicting observations in the context of transcriptomic, proteomic, or metabolomic datasets to identify patterns .

What statistical approaches are most appropriate for analyzing slr0269 expression data?

For rigorous statistical analysis of slr0269 expression data:

  • Normalization methods: Apply appropriate normalization strategies for RNA-seq data, considering the unique aspects of cyanobacterial transcriptomes.

  • Differential expression analysis: Utilize packages like DESeq2 or edgeR that account for biological variability.

  • Time-series analysis: For temporal studies, apply methods specifically designed for time-course data, such as maSigPro or ImpulseDE2.

  • Multi-factor design analysis: Use ANOVA-like approaches when testing multiple environmental factors simultaneously.

  • Correlation network analysis: Identify genes with similar expression patterns to place slr0269 in a functional context.

  • Multiple testing correction: Apply appropriate corrections (e.g., Benjamini-Hochberg) when conducting numerous comparisons.

What expression systems are optimal for producing recombinant slr0269 for in vitro studies?

For optimal production of recombinant slr0269:

Expression SystemAdvantagesLimitationsOptimization Notes
E. coli BL21(DE3)High yield, easy handlingPotential folding issuesConsider using molecular chaperones
Synechocystis hostNative folding environmentLower yieldUse strong inducible promoters
Cell-free systemsRapid production, toxic toleranceHigher costOptimize reaction conditions
Yeast expressionPost-translational modificationsExpression biasCodon optimization may be required

When working with E. coli expression systems:

  • Test multiple induction conditions (IPTG concentration, temperature, duration)

  • Consider fusion tags that enhance solubility (MBP, SUMO, etc.)

  • Validate protein functionality after purification

What purification methods are most effective for recombinant slr0269?

For effective purification of recombinant slr0269:

  • Affinity chromatography options:

    • His-tag purification using Ni-NTA or TALON resins

    • GST-tag purification for enhanced solubility

    • FLAG or Strep-tag II for high specificity applications

  • Buffer optimization:

    • Test various pH conditions (typically pH 7.0-8.0 for cyanobacterial proteins)

    • Optimize salt concentration to maintain stability while reducing non-specific binding

    • Consider including stabilizing agents such as glycerol or reducing agents if appropriate

  • Additional purification steps:

    • Size exclusion chromatography to achieve high purity and assess oligomeric state

    • Ion exchange chromatography as a polishing step

    • Removal of affinity tags if they interfere with functional studies

  • Quality control assessments:

    • SDS-PAGE for purity evaluation

    • Mass spectrometry for identity confirmation

    • Circular dichroism to verify proper folding

    • Activity assays to confirm functionality

How can researchers effectively validate the specificity of antibodies against slr0269?

For rigorous validation of antibodies against slr0269:

  • Western blot controls:

    • Use wild-type and knockout strains (if available) to confirm specificity

    • Include recombinant slr0269 as a positive control

    • Test pre-immune serum as a negative control

    • Perform peptide competition assays to confirm epitope specificity

  • Cross-reactivity assessment:

    • Test against closely related cyanobacterial species

    • Examine potential cross-reactivity with homologous proteins in Synechocystis

    • Validate in different sample types (whole cell extracts, membrane fractions, etc.)

  • Alternative validation approaches:

    • Immunoprecipitation followed by mass spectrometry

    • Immunofluorescence microscopy with appropriate controls

    • Epitope tagging of slr0269 to allow validation with commercial tag antibodies

How can CRISPR/Cas9 technology be leveraged for advanced functional studies of slr0269?

CRISPR/Cas9 technology offers several advanced applications for slr0269 functional studies:

  • CRISPRi approach: Use catalytically inactive Cas9 (dCas9) fused to repressor domains to modulate slr0269 expression without genetic modification .

  • CRISPRa systems: Employ dCas9 fused to activation domains to upregulate slr0269 expression for gain-of-function studies.

  • Base editing: Apply CRISPR base editors to introduce specific point mutations without double-strand breaks.

  • Protein tagging: Use CRISPR to introduce epitope tags or fluorescent proteins as C-terminal or N-terminal fusions for localization and interaction studies .

  • Multiplexed editing: Target slr0269 simultaneously with other genes to study genetic interactions and redundancies.

  • Inducible systems: Develop systems that allow temporal control of slr0269 editing or expression modulation .

What emerging technologies might enhance our understanding of slr0269 function?

Emerging technologies with potential applications for slr0269 research include:

  • Single-cell transcriptomics: Investigate cell-to-cell variability in slr0269 expression within Synechocystis populations.

  • Proximity labeling: Apply BioID or APEX2 approaches to identify proteins that interact with or function near slr0269 in vivo.

  • Cryo-electron microscopy: Determine high-resolution structures of slr0269 alone or in complex with interaction partners.

  • Protein fitness landscape mapping: Apply methods similar to those used for DHFR to understand sequence-function relationships for slr0269 .

  • Synthetic biology approaches: Create synthetic circuits incorporating slr0269 to test hypothesized functions in controlled contexts.

  • Long-read sequencing: Apply to transcriptome analysis to better understand operon structure and potential alternative transcripts involving slr0269 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.