Recombinant Synechocystis sp. Uncharacterized protein slr0272 (slr0272)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
slr0272; Uncharacterized protein slr0272
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-325
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
slr0272
Target Protein Sequence
MTTPVFCTNCGNRLSPQVRFCESCGCPVALTSEPPSFSGPPLSPLPPPPPTFNVDEVPSH KRGVTPWIPFFLLFSSVVVLGGLWWLGAFNLPQWNQWLVKILPTNTSSPVVTSPTPTVAP VDANAVSLEDFVGVWMVMEGAPGEGGEAIFTMSLEGNVIVVEAEGDRVEFPTLNGRKLEG SVVEDGVTIPITVELNQNKDQIIVTVLPPNSELQVGVGQRVKGIDDLDSPSNSRDNSLNI DENVLTERQALELLIAWPEIADWMQRVQQEAPQNQTLLEIVETTPQQYLIRAYESVNNPG EPGHTATFGWYNVDRQTGEVTQSIP
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is known about the expression profile of slr0272 in Synechocystis sp. PCC 6803?

According to genomic studies, slr0272 shows significant expression changes in response to redox treatments. Specifically, DNA microarray analysis revealed that slr0272 has an expression change of 1.55 ± 0.68 fold when treated with DCMU (3-(3,4-dichlorophenyl)-1,1-dimethylurea) and 5.66 ± 2.86 fold with DBMIB treatment . The protein is also marked with an "R" designation under certain stress conditions, indicating possible repression in these contexts. This expression pattern suggests slr0272 may be involved in redox-responsive pathways within the cyanobacterium.

How is slr0272 regulated at the transcriptional level?

Transcriptomic analyses indicate that slr0272 belongs to redox-responsive gene Group II, with notable upregulation in response to specific electron transport chain inhibitors . To properly characterize its regulation:

  • Perform dRNA-seq (differential RNA sequencing) to identify the transcriptional start site (TSS) of slr0272

  • Analyze the promoter region for regulatory elements, particularly those associated with redox-responsive transcription factors

  • Conduct RT-qPCR validation under various environmental conditions (light intensity, temperature, nutrient availability)

Genome-wide transcriptome maps of Synechocystis under multiple conditions have identified over 4,091 transcriptional units , providing a framework for understanding slr0272's regulation in the context of global gene expression patterns.

What approaches should I use to express recombinant slr0272 protein in Synechocystis?

For optimal expression of recombinant slr0272 in Synechocystis sp. PCC 6803, consider these methodological approaches:

  • Promoter selection: Use either the native promoter or stronger constitutive promoters like the cpc promoter, which has shown 2-3 fold higher expression compared to moderate promoters like PpsbA2 .

  • Expression vector design: Integrate the expression cassette into a neutral genomic site (e.g., near slr0846 or IS203c) to minimize disruption of normal cellular functions .

  • Verification protocol:

    • Confirm complete segregation in all genome copies via colony PCR

    • Verify protein expression through Western blotting (note that even with successful integration, protein bands may not be detectable in SDS-PAGE, as commonly observed with recombinant proteins in Synechocystis)

  • Culture optimization: Culture cells at 30°C under continuous white light illumination of 50–80 µmol quanta m⁻² s⁻¹ with continuous aeration until OD₇₅₀ = 0.6–0.8 .

How do I design experiments to characterize the function of slr0272 in Synechocystis?

To systematically characterize slr0272 function, implement this comprehensive experimental design:

Step 1: Define Variables

  • Independent variables: Gene expression levels, environmental conditions (redox state, light intensity, temperature)

  • Dependent variables: Cellular phenotype, metabolic output, interaction partners

  • Control for extraneous variables: Use isogenic strains under identical growth conditions

Step 2: Generate Testable Hypotheses
Based on its expression profile in Group II redox-responsive genes, hypothesize that slr0272 may function in:

  • Stress response pathways

  • Redox regulation

  • Photosynthetic electron transport

Step 3: Design Experimental Treatments

  • Create a complete knockout (Δslr0272) using homologous recombination with antibiotic resistance markers

  • Develop complementation strains using the trc promoter for controlled expression

  • Prepare point mutations at conserved residues to identify functional domains

  • Subject strains to multiple stress conditions (high light, cold stress, heat stress, iron limitation)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.