Recombinant Synechocystis sp. Uncharacterized protein slr0964 (slr0964)

Shipped with Ice Packs
In Stock

Description

Functional Role in Iron Homeostasis

Slr0964 has been identified as FTR1, an iron permease critical for Fe³⁺ uptake under iron-deficient conditions . Key findings include:

Functional AnnotationRegulatory MechanismExperimental Evidence
Iron permease activityBinds promoter motifs (Motif-1, -2, -3) under IutR1 transcriptional regulation ChIP-seq, RT-qPCR
Integration into Fe uptakePart of TonB-dependent transport system with Slr1484 (TonB protein) Transcriptomic analysis
Stress responseUpregulated during Fe deprivationGrowth assays, EMSA

This protein facilitates iron acquisition alongside other transporters like FutABC and Fec systems, forming a network essential for cyanobacterial survival in low-iron environments .

Research Applications and Future Directions

  1. Mechanistic Studies: Slr0964 serves as a model for probing cyanobacterial iron transport and regulatory networks .

  2. Biotechnological Engineering: Potential applications in biofortification or synthetic biology for enhancing metal uptake in crops .

  3. Structural Biology: The protein’s transmembrane domains are targets for crystallography or cryo-EM to resolve transport mechanisms .

Knowledge Gaps and Challenges

  • Functional Redundancy: Homologous systems (e.g., FutA1/A2) may compensate for Slr0964 deletion, complicating phenotypic analysis .

  • Regulatory Crosstalk: Interactions with transcription factors like FurA and PerR require further validation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we are happy to accommodate specific requirements for the format. Please clearly indicate your preference when placing your order, and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
slr0964; Uncharacterized protein slr0964
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
slr0964
Target Protein Sequence
MDFASGLPIFIVTLREALEASLVVGIVLACLARAQQMQLKGWVYRGISAGVVASVLVGCL LAGVLQGVERLPGPYTPILKALLAALLGAIAVGMLSWMLLWMTKQARSLRGEIQGQINQA VEKEGGGKAIAIVVFIAVVREGFEMVLFLAAQQNMANPAAIGAALAGIGTAVVMAFLIFR LGVKLNLKLFFQVMGTLLLIIVGGLVIGVLKNLDLAVSMMGLANLGLGYLCFVPGDSCLL GPLLWNLAPWLPDNQFPGIVLKTLAGYRDHLYLFQAIAYGIFLSVIGSLYFRGLAGKGDA PQAVAQKS
Uniprot No.

Target Background

Database Links
Protein Families
Oxidase-dependent Fe transporter (OFeT) (TC 9.A.10.1) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are suitable for producing recombinant slr0964 protein?

E. coli expression systems have been successfully used to produce recombinant slr0964 protein. The recommended approach involves:

  • Gene synthesis or PCR amplification of the slr0964 gene (924 bp)

  • Cloning into an expression vector with an N-terminal His-tag

  • Transformation into an E. coli expression strain (BL21(DE3) or similar)

  • Induction of protein expression using IPTG (typically 0.1-1.0 mM)

  • Cell lysis and protein purification using nickel affinity chromatography

  • Quality assessment by SDS-PAGE and Western blotting

The recombinant protein has been successfully produced with greater than 90% purity using this methodology. The lyophilized powder form of the purified protein should be stored at -20°C/-80°C and reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, preferably with 5-50% glycerol as a cryoprotectant .

How should recombinant slr0964 protein be stored and handled in laboratory settings?

For optimal stability and activity of recombinant slr0964 protein:

Storage ConditionRecommendationNotes
Short-term storage4°CSuitable for up to one week
Long-term storage-20°C/-80°CAliquoting necessary for multiple use
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0Maintains protein stability
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLBrief centrifugation prior to opening recommended
Cryoprotection5-50% glycerol (final concentration)Default recommendation is 50%

Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and activity loss. When working with the protein, maintain sterile conditions and use appropriate protein handling techniques to prevent contamination and degradation .

What methodologies are most effective for determining the function of slr0964 as an uncharacterized protein?

The functional characterization of uncharacterized proteins like slr0964 requires a multi-faceted approach:

  • Bioinformatic analysis:

    • Sequence homology searches against characterized proteins

    • Structural prediction using tools like AlphaFold or Rosetta

    • Functional domain identification and comparison

    • Genomic context analysis to identify operon structures or related genes

  • Genetic approaches:

    • Gene knockout or knockdown using CRISPR-Cas9 or other genetic tools

    • Phenotypic analysis under various stress conditions

    • Complementation studies

    • Synthetic genetic array analysis to identify genetic interactions

  • Biochemical approaches:

    • In vitro activity assays based on predicted functions

    • Protein-protein interaction studies (pull-down assays, yeast two-hybrid)

    • Metabolomic analysis of mutant strains

    • Structural studies using X-ray crystallography or cryo-EM

For slr0964 specifically, based on the amino acid sequence analysis suggesting membrane-associated properties, techniques like membrane protein topology mapping and localization studies would be particularly valuable. Additionally, adaptive laboratory evolution experiments under various stress conditions, similar to those performed for identifying the roles of hik26 and slr1916 in high light stress tolerance, could reveal phenotypes associated with slr0964 mutations .

How might slr0964 potentially relate to stress response mechanisms in Synechocystis sp., particularly in the context of high light stress?

While direct evidence linking slr0964 to high light stress response is not available in the provided search results, several methodological approaches can be used to investigate this potential relationship:

  • Expression analysis under stress conditions:

    • RT-qPCR to measure slr0964 transcript levels under varying light intensities

    • Proteomics analysis to detect changes in slr0964 protein abundance

    • Reporter gene assays using the slr0964 promoter to monitor transcriptional responses

  • Functional studies in stress response:

    • Generate and characterize slr0964 deletion or overexpression strains

    • Assess growth and photosynthetic parameters under high light conditions (similar to the experiments performed with hik26 and slr1916 mutants)

    • Measure photosystem damage and repair rates in wild-type vs. mutant strains

  • Integration with known stress response pathways:

    • Analyze epistatic relationships with known stress response genes like hik26 and slr1916

    • Investigate potential interactions with the isiA gene, which showed increased expression in high light tolerant strains

    • Examine connections to photosystem II repair mechanisms

  • Adaptive laboratory evolution approach:

    • Subject wild-type and slr0964 mutant strains to adaptive laboratory evolution under high light conditions

    • Compare mutation frequencies and patterns

    • Assess whether mutations in slr0964 emerge in independently evolved stress-tolerant lines

This systematic approach would help determine whether slr0964 plays a role in high light stress tolerance, potentially similar to or distinct from the roles of hik26 and slr1916 that have been identified in previous research .

What techniques can be employed to investigate the potential interactions between slr0964 and other membrane proteins in Synechocystis sp.?

Investigating protein-protein interactions for membrane proteins like slr0964 requires specialized approaches:

  • In vivo crosslinking methods:

    • Chemical crosslinking with membrane-permeable reagents

    • Photo-crosslinking with genetically incorporated unnatural amino acids

    • Proximity-dependent biotin labeling (BioID or APEX)

  • Affinity-based methods:

    • Pull-down assays with tagged slr0964 followed by mass spectrometry

    • Co-immunoprecipitation with antibodies against slr0964

    • Tandem affinity purification to identify stable interaction partners

  • Genetic interaction screens:

    • Synthetic genetic array analysis

    • Suppressor mutation screens

    • Two-hybrid systems adapted for membrane proteins (MYTH, split-ubiquitin)

  • Structural biology approaches:

    • Blue native PAGE to identify native protein complexes

    • Cryo-electron microscopy of purified membrane fractions

    • Cross-linking mass spectrometry (XL-MS)

  • Biophysical methods:

    • Förster resonance energy transfer (FRET)

    • Bioluminescence resonance energy transfer (BRET)

    • Fluorescence correlation spectroscopy

For slr0964 specifically, investigating interactions with proteins involved in high light stress response, such as those in the photosynthetic apparatus or stress signaling pathways, would be particularly valuable. Additionally, examining potential interactions with hik26 (a two-component sensor histidine kinase) and slr1916 (a probable esterase) could reveal functional connections to the high light stress tolerance mechanisms identified in previous research .

What are the optimal conditions for expressing and purifying recombinant slr0964 protein for structural studies?

For structural studies of slr0964, high-purity protein preparations are essential. The following optimized protocol is recommended:

StageMethodologySpecific Conditions
Expression systemE. coli BL21(DE3)Transformed with a vector containing slr0964 with an N-terminal His-tag
Culture conditionsLB or Terrific Broth37°C growth to OD600 = 0.6-0.8, then 18°C post-induction
InductionIPTG0.1-0.5 mM, overnight induction at 18°C
Cell lysisSonication or pressure-basedIn buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, protease inhibitors
Primary purificationIMAC (Ni-NTA)Imidazole gradient (20-300 mM) for elution
Secondary purificationSize exclusion chromatographyUsing Superdex 200 column in 25 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol
Detergent screeningFor membrane proteinsTest DDM, LMNG, C12E8, and others for optimal solubilization
Quality assessmentSDS-PAGE, Western blot, DLSEnsure >95% purity and monodispersity
ConcentrationCentrifugal concentrators10 kDa MWCO, avoid precipitation
StorageFlash freezingSmall aliquots in liquid nitrogen

For crystallization trials, perform extensive detergent screening and stability tests. If difficulty persists with the full-length protein, consider using truncated constructs based on domain predictions or limited proteolysis experiments. For cryo-EM studies, reconstitution into nanodiscs or amphipols may provide a more native-like membrane environment .

How can researchers design experiments to investigate potential roles of slr0964 in the context of adaptive laboratory evolution studies?

Adaptive laboratory evolution (ALE) experiments can be powerful for uncovering the functional roles of uncharacterized proteins like slr0964. A systematic experimental design would include:

  • Initial strain construction:

    • Generate slr0964 knockout, knockdown, and overexpression strains

    • Create reporter strains with fluorescent tags to monitor slr0964 expression

    • Develop strains with point mutations in key predicted functional domains

  • ALE experimental design:

    • Subject wild-type and modified strains to parallel evolution under varying stress conditions (light intensity, temperature, nutrient limitation)

    • Implement increasing selection pressure gradually (e.g., incrementally increase light intensity from 4000 to 9000 μmol m⁻² s⁻¹ as described for hik26/slr1916 studies)

    • Maintain multiple independent replicate cultures for robust statistical analysis

    • Perform regular sampling for phenotypic and genotypic analysis

  • Analytical methods for evolved strains:

    • Whole-genome sequencing to identify adaptive mutations

    • Transcriptome analysis (RNA-seq) to detect expression changes

    • Proteomics to identify changes in protein abundance and modifications

    • Metabolomics to detect changes in metabolic pathways

    • Photosynthetic performance analysis using PAM fluorometry

  • Validation experiments:

    • Reverse engineering of identified mutations using CRISPR-Cas9

    • Complementation studies to verify causality

    • Competition assays between evolved and ancestral strains

    • Cross-complementation between different evolved lineages

  • Integration with existing knowledge:

    • Compare findings with known stress response mechanisms

    • Examine relationships with hik26 and slr1916 mutations

    • Test for epistatic interactions with other stress response pathways

This approach mirrors the successful methodology used to identify the roles of hik26 and slr1916 in high light stress tolerance, where ALE experiments over 52 days under high light stress conditions (7000 to 9000 μmol m⁻² s⁻¹) led to the development of a tolerant strain with specific adaptive mutations .

What analytical techniques are most appropriate for determining the subcellular localization and membrane topology of slr0964?

Determining the subcellular localization and membrane topology of slr0964 requires specialized techniques for membrane proteins:

  • Prediction-based approaches:

    • Hydropathy analysis using algorithms like TMHMM, Phobius, or TOPCONS

    • Signal peptide prediction using SignalP

    • Membrane protein topology prediction using MEMSAT or OCTOPUS

  • Experimental localization methods:

    • Fluorescent protein fusion (GFP, mCherry) for live-cell imaging

    • Immunogold electron microscopy for high-resolution localization

    • Cell fractionation followed by Western blotting

    • Protease protection assays to determine membrane orientation

  • Topology mapping techniques:

    • Substituted cysteine accessibility method (SCAM)

    • PhoA/LacZ fusion reporter analysis

    • Glycosylation mapping using engineered glycosylation sites

    • Limited proteolysis combined with mass spectrometry

    • FRET-based distance measurements

  • Advanced microscopy approaches:

    • Super-resolution microscopy (STORM, PALM)

    • Correlative light and electron microscopy (CLEM)

    • Live-cell single-particle tracking

    • FRAP (Fluorescence Recovery After Photobleaching) for mobility assessment

Based on the amino acid sequence of slr0964, which contains multiple hydrophobic regions likely forming transmembrane domains, a combination of fluorescent protein fusion constructs and topology mapping using the substituted cysteine accessibility method would be particularly informative. Additionally, comparison with the localization patterns of functionally related proteins, such as those involved in high light stress response, could provide insights into functional relationships .

How can systems biology approaches be applied to understand the role of slr0964 in the broader context of cellular networks?

Systems biology provides powerful frameworks for placing uncharacterized proteins like slr0964 into functional contexts:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Analyze correlation networks to identify co-regulated genes/proteins

    • Implement machine learning approaches to predict functional associations

    • Perform temporal analyses across different stress conditions

  • Network biology approaches:

    • Construct protein-protein interaction networks

    • Develop gene regulatory networks incorporating transcription factors

    • Create metabolic models incorporating potential enzymatic functions

    • Analyze network topology to identify hub proteins and modules

  • Comparative genomics strategies:

    • Analyze conservation patterns across cyanobacterial species

    • Identify conserved gene neighborhoods and operons

    • Compare with related proteins in other photosynthetic organisms

    • Trace evolutionary patterns of gene gain/loss

  • Perturbation experiments:

    • Systematically perturb cellular systems and measure effects on slr0964

    • Use chemical genetics to probe functional relationships

    • Apply environmental stressors and measure system-wide responses

    • Develop synthetic genetic interaction maps

  • Mathematical modeling:

    • Develop dynamic models of stress response incorporating slr0964

    • Simulate perturbations and predict system behavior

    • Validate model predictions with experimental data

    • Refine models iteratively based on new findings

This systems approach is particularly relevant given the interconnected nature of stress response pathways in cyanobacteria. For example, the high light stress response identified in previous research involves multiple components including mutations in both hik26 (a sensor histidine kinase) and slr1916 (a probable esterase), suggesting complex regulatory networks .

What considerations should researchers take into account when designing CRISPR-Cas9 experiments for functional analysis of slr0964?

CRISPR-Cas9 approaches for functional analysis of slr0964 in Synechocystis sp. require careful consideration of several factors:

  • sgRNA design considerations:

    • Select target sites with high specificity and minimal off-target effects

    • Consider GC content and secondary structure of sgRNAs

    • Analyze target accessibility in the genomic context

    • Design multiple sgRNAs targeting different regions for validation

  • Modification strategies:

    • Complete knockout via frameshift mutations or large deletions

    • Point mutations to alter specific amino acids in predicted functional domains

    • Gene replacements with modified versions or reporter fusions

    • Conditional regulation using inducible promoters

  • Delivery and selection methods:

    • Optimize transformation protocols for Synechocystis

    • Implement appropriate antibiotic selection strategies

    • Consider marker-free approaches for sequential modifications

    • Use counter-selection for scarless modifications

  • Validation approaches:

    • PCR and sequencing to confirm genomic modifications

    • RT-qPCR and Western blotting to verify expression changes

    • Phenotypic assays under various conditions (particularly high light stress)

    • Complementation studies to confirm gene-phenotype relationships

  • Control considerations:

    • Include wild-type controls

    • Generate control mutations in non-coding regions

    • Create repair template-only controls

    • Design frameshift controls that lack protein function but maintain RNA structure

The experimental design should take into account the potential phenotypes associated with slr0964 modification, particularly in the context of stress responses. Based on research with other uncharacterized proteins in Synechocystis sp., testing mutant strains under high light conditions (similar to the 7000-9000 μmol m⁻² s⁻¹ used in previous studies) may reveal phenotypes that are not apparent under standard growth conditions .

How might comparative analysis of slr0964 with similar proteins in other cyanobacterial species inform understanding of its function?

Comparative analysis across cyanobacterial species provides a powerful approach to understanding slr0964:

  • Phylogenetic analysis:

    • Construct phylogenetic trees of slr0964 homologs

    • Map functional annotations onto phylogenetic relationships

    • Identify patterns of gene duplication and specialization

    • Correlate evolutionary patterns with ecological niches

  • Sequence conservation patterns:

    • Identify highly conserved residues as potential functional sites

    • Analyze differential conservation across protein domains

    • Examine coevolving residues for functional coupling

    • Compare conservation patterns with known functional proteins

  • Genomic context analysis:

    • Compare operon structures and gene neighborhoods

    • Identify conserved regulatory elements

    • Analyze synteny across diverse cyanobacterial genomes

    • Map genomic rearrangements to understand evolutionary history

  • Functional replacement experiments:

    • Test complementation with homologs from diverse species

    • Identify species-specific functional differences

    • Create chimeric proteins to map functional domains

    • Analyze variations in stress response phenotypes

  • Ecological and physiological correlations:

    • Correlate protein features with habitat conditions

    • Analyze expression patterns across diverse species

    • Examine relationships to photosynthetic capacity

    • Investigate connections to stress tolerance mechanisms

This comparative approach is particularly valuable for uncharacterized proteins like slr0964, as it can reveal functional associations that are not apparent from sequence analysis alone. Given the identification of stress response roles for other uncharacterized proteins in Synechocystis sp., such as the role of slr1916 in high light stress tolerance, similar patterns may emerge for slr0964 through comparative analysis .

What are the potential implications of slr0964 research for biotechnological applications in photosynthetic microorganisms?

Research on slr0964 and other uncharacterized proteins in cyanobacteria has several potential biotechnological applications:

  • Stress tolerance engineering:

    • Development of cyanobacterial strains with enhanced light tolerance

    • Engineering resistance to multiple environmental stressors

    • Creation of robust production strains for outdoor cultivation

    • Optimization of photosynthetic efficiency under varying conditions

  • Biosensor development:

    • Using slr0964 promoter or protein as sensing elements

    • Creating reporter systems for specific environmental conditions

    • Developing whole-cell biosensors for ecological monitoring

    • Engineering feedback-controlled production systems

  • Metabolic engineering applications:

    • Incorporating stress response mechanisms into production strains

    • Enhancing carbon fixation efficiency

    • Optimizing energy distribution in photosynthetic systems

    • Developing switchable production systems

  • Synthetic biology platforms:

    • Using characterized parts from stress response systems

    • Developing orthogonal regulatory circuits

    • Creating tunable expression systems

    • Engineering novel protein functions based on structural insights

  • Bioremediation approaches:

    • Developing cyanobacterial strains for contaminant degradation

    • Engineering enhanced metal tolerance and accumulation

    • Creating robust strains for wastewater treatment

    • Designing systems for CO2 capture and utilization

The research on high light tolerance in Synechocystis sp. provides a model for how understanding uncharacterized proteins can lead to biotechnological applications. The identification of mutations in hik26 and slr1916 that confer high light tolerance demonstrates how fundamental research on uncharacterized proteins can lead to improvements in photosynthetic efficiency and stress tolerance, which are critical for industrial applications of cyanobacteria .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.