Recombinant Synechocystis sp. Uncharacterized protein slr1261 (slr1261)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Synechocystis sp. Uncharacterized protein slr1261 (slr1261) is a protein derived from the cyanobacterium Synechocystis sp., specifically strain PCC 6803 . The slr1261 protein is considered an uncharacterized protein, meaning its precise function within the organism is not yet fully understood . Proteins of this nature are often identified through genome sequencing and bioinformatic analysis, but their roles require further experimental investigation to elucidate .

Table 1: General Characteristics of Recombinant Synechocystis sp. Uncharacterized Protein slr1261 (slr1261)

CharacteristicDescription
Source OrganismSynechocystis sp. PCC 6803
Protein Length1-179 amino acids (Full Length)
TagHis-Tagged
Expression HostE. coli
PurityGreater than 85% as determined by SDS-PAGE
Synonymsslr1261; Uncharacterized protein slr1261
UniProt IDP73801

Production and Characteristics

Recombinant slr1261 is produced using E. coli as an expression host . The protein is fused to an N-terminal His tag to facilitate purification using affinity chromatography . The recombinant protein is available as a lyophilized powder and should be reconstituted in deionized sterile water . The typical concentration for reconstitution ranges from 0.1 to 1.0 mg/mL . For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% and store aliquots at -20°C or -80°C . Repeated freezing and thawing should be avoided to maintain protein integrity .

Potential Functions and Role in Synechocystis sp. PCC 6803

While slr1261 is currently annotated as an uncharacterized protein, several studies provide insights into potential functions and related proteins in Synechocystis sp. PCC 6803:

  • Carbohydrate Metabolism Regulation: Slr0110 has been identified as a central regulator of carbohydrate metabolism in Synechocystis sp. PCC6803 . Deletion of slr0110 results in defects in glucose uptake, heterotrophic growth, and dark viability, suggesting a crucial role in carbon metabolism .

  • Myxoxanthophyll Biosynthesis: Slr1293, also known as CrtD, is a C-3′,4′ desaturase involved in myxoxanthophyll biosynthesis . Myxoxanthophyll is a polar carotenoid glycoside that constitutes a significant portion of the total carotenoids in Synechocystis under high light intensity .

  • S-Layer Protein: Sll1951 is identified as the S-layer protein in Synechocystis sp. PCC 6803 . Deletion of sll1951 results in the absence of the S-layer lattice on the cell surface, leading to reduced viability upon exposure to lysozyme treatment and hypo-osmotic stress .

  • PHB Metabolism: Slr0060 is potentially involved in polyhydroxybutyrate (PHB) metabolism . Although a knockout strain of slr0060 showed only minor differences in vegetative growth, it exhibited increased chlorophyll content and reduced PHB production .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
slr1261; Uncharacterized protein slr1261
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
slr1261
Target Protein Sequence
MASSTQTNVTIAPKTLQQLRQQDAVILVDVREPLEFVGEHITDAYSLPLSRLNPSQLPQA EGKTTVLYCQSSNRSGNALQQLRSAGVEGIIHLEGGLLAWKQAGLPTVKTKNAPISIMRQ VQIIAGSLVLTGVLLGSFVAPGFYFLSGFVGAGLLFAGLSGTCMMANLLGKLPYNQIKD
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the current status of slr1261 characterization in Synechocystis sp. PCC 6803?

The protein slr1261 in Synechocystis sp. PCC 6803 remains largely uncharacterized in terms of its specific biological function. Similar to other proteins initially identified through genome sequencing projects, slr1261 has been annotated based on sequence homology but lacks experimental verification of its biological role. Current research approaches focus on determining its function through comparative genomics, expression analysis under various growth conditions, and knockout/knockdown studies. Researchers investigating slr1261 should consider implementing CRISPRi-based repression methodologies, which have been successfully employed for genome-wide functional studies in Synechocystis sp. PCC 6803 .

What experimental approaches are recommended for initial characterization of slr1261?

For initial characterization of slr1261, a systematic approach combining multiple methodologies is recommended:

  • Sequence analysis: Perform bioinformatic analysis to identify conserved domains, potential homologs in other organisms, and predicted secondary structure.

  • Expression profiling: Analyze expression patterns under various growth conditions (light intensity, nutrient availability, stress conditions) using RT-qPCR or RNA-Seq approaches.

  • Protein localization: Create GFP fusion constructs to determine subcellular localization within Synechocystis cells.

  • Gene disruption/repression: Implement CRISPRi-based repression to evaluate phenotypic changes similar to methodologies described for genome-wide screening in Synechocystis .

  • Protein-protein interaction studies: Perform pull-down assays or yeast two-hybrid screening to identify potential interaction partners.

This multi-faceted approach provides complementary data streams to develop initial hypotheses regarding slr1261 function within cyanobacterial metabolism.

How should I design a knockout experiment for slr1261 in Synechocystis sp.?

When designing a knockout experiment for slr1261, consider the following methodological framework:

  • Experimental hypothesis formulation: Clearly define your variables and how they are related. Your independent variable is the presence/absence of functional slr1261, while dependent variables should include growth rate, photosynthetic parameters, stress responses, or metabolic profiles depending on your hypothesis .

  • Construct design: Create a knockout construct with homologous regions flanking the slr1261 gene and an antibiotic resistance cassette for selection. Alternatively, consider using CRISPRi repression which allows for studying essential genes that may not be amenable to complete knockout .

  • Transformation and selection: Transform wild-type Synechocystis using natural transformation, and select transformants on appropriate antibiotic-containing media.

  • Confirmation of mutation: Verify complete segregation through PCR and sequencing. For CRISPRi repression, confirm reduced expression through RT-qPCR or Western blotting.

  • Phenotypic characterization: Assay for phenotypic differences between wild-type and mutant strains under multiple growth conditions, including standard growth conditions, high light, nutrient limitation, and various stress conditions that may reveal condition-specific functions .

  • Complementation: Reintroduce the wild-type gene to confirm that observed phenotypes are specifically due to the absence of slr1261.

This systematic approach follows standard experimental design principles while addressing the specific challenges of working with cyanobacterial systems .

How can transcriptomic analysis be integrated with metabolomic approaches to characterize slr1261 function?

Integrating transcriptomic and metabolomic approaches provides a powerful framework for elucidating slr1261 function through systems biology. The methodology should follow this research framework:

  • Experimental design preparation:

    • Generate a slr1261 knockout/knockdown strain and control strain

    • Select appropriate growth conditions, including standard and stress conditions that might reveal phenotypic differences

    • Plan sampling timepoints for both transcriptomic and metabolomic analyses

  • Transcriptomic analysis:

    • Perform RNA-Seq on wild-type and Δslr1261 strains under selected conditions

    • Identify differentially expressed genes and affected pathways

    • Look for co-regulated gene clusters that might indicate functional relationships

  • Metabolomic analysis:

    • Implement both targeted and untargeted metabolomics approaches

    • Compare metabolite profiles between wild-type and mutant strains

    • Identify significantly altered metabolites and affected metabolic pathways

  • Data integration:

    • Correlate changes in transcript levels with metabolite abundance

    • Construct pathway models incorporating both transcriptomic and metabolomic data

    • Identify regulatory networks potentially involving slr1261

This integrated approach is similar to that used for analyzing carbon supply shifts in Synechocystis, where both transcriptomic and metabolomic changes were characterized in response to environmental perturbations . The combined dataset provides deeper insight than either method alone, allowing researchers to distinguish between primary and secondary effects of slr1261 deletion.

What strategies can resolve contradictory data when investigating slr1261 function?

When facing contradictory data regarding slr1261 function, implement the following systematic resolution strategy:

  • Validate experimental techniques:

    • Confirm knockout/knockdown efficiency through multiple methods (qPCR, Western blot)

    • Verify strain identity to rule out contamination or spontaneous mutations

    • Replicate experiments using different experimental approaches

  • Evaluate growth conditions:

    • Test whether contradictions are condition-dependent (light intensity, media composition, growth phase)

    • Standardize growth protocols across experiments to ensure comparability

    • Consider circadian or light-dependent effects that may influence results

  • Consider redundancy and compensation:

    • Investigate potential paralogs or functionally redundant proteins

    • Perform double knockout experiments if redundancy is suspected

    • Examine adaptive responses that might mask primary effects

  • Cross-validate with different approaches:

    • If transcriptomic data contradicts phenotypic observations, validate with proteomics

    • If in vitro biochemical assays conflict with in vivo observations, consider cellular context

    • Implement in situ techniques to observe protein behavior in native conditions

  • Data integration framework:

    Data TypeContradictory ObservationResolution Approach
    Growth phenotypeInconsistent growth effectsStandardize growth conditions and measure growth parameters at multiple timepoints
    Gene expressionVariability in differential expressionValidate with multiple techniques (RNA-Seq, qPCR, microarray)
    Protein functionConflicting biochemical activitiesPurify protein from native host vs. recombinant systems
    Metabolic impactInconsistent metabolite changesConsider metabolic flux analysis rather than static concentrations

This methodical approach acknowledges that biological systems are complex and that contradictions often reveal important regulatory mechanisms or condition-specific functions that provide deeper insight into protein function .

How should researchers approach experimental design for studying potential involvement of slr1261 in carotenoid biosynthesis?

When investigating slr1261's potential role in carotenoid biosynthesis, researchers should implement this structured experimental design:

  • Hypothesis development:

    • Formulate a specific hypothesis about slr1261's role based on sequence similarity to known carotenoid biosynthesis enzymes or regulatory proteins

    • Define predicted enzymatic or regulatory function (e.g., potential desaturase, cyclase, or regulatory activity)

  • Comparative analysis with characterized carotenoid biosynthesis genes:

    • Compare sequence and structural features with characterized proteins like Slr1293 (CrtD), which functions as a C-3',4' desaturase in myxoxanthophyll biosynthesis

    • Analyze gene clustering and co-expression patterns with known carotenoid synthesis genes

  • Complementation studies in heterologous systems:

    • Express slr1261 in E. coli strains engineered to accumulate carotenoid intermediates, similar to approaches used for Slr1293 characterization

    • Analyze accumulated carotenoids using HPLC and mass spectrometry to identify modified intermediates

  • In vivo functional analysis in Synechocystis:

    • Create slr1261 deletion mutants and analyze carotenoid profiles

    • Subject mutants to high light conditions to assess photoprotective capacity, as carotenoids play critical roles in photoprotection

    • Analyze gene expression changes in carotenoid biosynthesis pathways in response to slr1261 deletion

  • Metabolic flux analysis:

    • Implement isotope labeling to track carbon flow through the carotenoid biosynthesis pathway in wild-type and Δslr1261 strains

    • Quantify differences in flux distribution to identify specific steps affected by slr1261 deletion

This structured approach parallels successful strategies used to characterize Slr1293 (CrtD) as essential for myxoxanthophyll biosynthesis in Synechocystis , while incorporating modern metabolic flux approaches to provide mechanistic insights into pathway regulation and function.

What CRISPRi-based approaches are most effective for studying slr1261 function?

For effective CRISPRi-based functional analysis of slr1261, researchers should implement the following optimized methodology:

  • sgRNA design considerations:

    • Design multiple sgRNAs targeting different regions of slr1261 to ensure effective repression

    • Select target sites near the transcription start site for maximum repression efficiency

    • Evaluate potential off-target effects using genome-wide specificity analysis tools

    • Include non-targeting control sgRNAs to establish baseline expression and phenotypes

  • Repression system optimization:

    • Use an inducible promoter (such as Ptet) to control dCas9 expression, allowing for temporal regulation of repression

    • Validate repression efficiency using RT-qPCR or RNA-Seq to quantify target gene knockdown

    • Optimize inducer concentration to achieve desired level of repression (partial vs. near-complete)

  • Phenotypic screening approach:

    • Implement growth measurements under multiple conditions to identify condition-specific phenotypes

    • Consider competition-based assays to detect subtle fitness effects

    • Apply selective pressures relevant to hypothesized function (e.g., high light, nutrient limitation)

  • Integration with pooled screening approaches:

    • For high-throughput analysis, consider incorporating slr1261 repression strains into pooled libraries

    • Use barcode sequencing to track relative abundance over time under various conditions

    • Apply fluorescence-activated cell sorting (FACS) to isolate cells with desired phenotypes

This CRISPRi approach has been successfully implemented for genome-wide functional analysis in Synechocystis, allowing for precise control of gene expression and identification of condition-specific gene functions . The methodology is particularly valuable for uncharacterized genes like slr1261, as it enables both complete and partial repression, providing insights into gene function even when complete knockout is lethal.

How can researchers effectively analyze potential regulatory roles of slr1261 in stress responses?

To systematically investigate slr1261's potential regulatory role in stress responses, implement this comprehensive analytical framework:

  • Expression profiling under diverse stress conditions:

    • Measure slr1261 expression under multiple stress conditions (high light, nutrient deprivation, temperature stress, oxidative stress)

    • Use time-course experiments to capture dynamic expression changes

    • Compare expression patterns with known stress-responsive genes

    Stress ConditionMeasurement TimepointsKey Control Genes
    High Light0, 15, 30, 60, 120 minpmgA, rpaB, bcp2
    Oxidative Stress (H₂O₂)0, 15, 30, 60, 120 minperoxiredoxins, catalase
    Nutrient Limitation (N, P, S)0, 6, 12, 24, 48 hNutrient-specific transporters
    Temperature Stress0, 30, 60, 120, 240 minHeat/cold shock proteins
  • Genome-wide impact of slr1261 deletion/repression:

    • Perform RNA-Seq analysis comparing wild-type and Δslr1261 strains under both standard and stress conditions

    • Identify differentially expressed genes and affected pathways

    • Apply regulatory network analysis to identify potential direct and indirect targets

    • Look for enrichment of specific regulatory motifs in affected genes

  • Protein-DNA interaction studies:

    • If sequence analysis suggests DNA-binding domains, perform chromatin immunoprecipitation sequencing (ChIP-seq)

    • Identify genomic binding sites and associated genes

    • Validate direct regulation through reporter gene assays

  • Protein modification and interaction analysis:

    • Investigate post-translational modifications under different stress conditions

    • Identify protein interaction partners using co-immunoprecipitation or yeast two-hybrid screens

    • Analyze changes in protein-protein interactions in response to stress

  • Functional validation through targeted approaches:

    • Create constructs with mutations in predicted functional domains

    • Perform complementation studies with modified versions of slr1261

    • Use fluorescent reporters to visualize activation of stress-responsive pathways

This systematic approach parallels successful strategies used to characterize regulatory proteins in Synechocystis, such as RpaB, which has been identified as a key regulator in high-light responses . The integration of genome-wide approaches with targeted validation provides a comprehensive understanding of regulatory networks and mechanisms.

What are the best practices for purification and biochemical characterization of recombinant slr1261?

For optimal purification and biochemical characterization of recombinant slr1261, implement this detailed methodological workflow:

  • Expression system selection and optimization:

    • Compare expression in E. coli, yeast, and cell-free systems to identify optimal host

    • Test multiple expression vectors with different promoters, fusion tags, and solubility enhancers

    • Optimize expression conditions (temperature, inducer concentration, growth media)

    • Consider codon optimization for the selected expression host

    Expression SystemAdvantagesConsiderations
    E. coliHigh yield, simple manipulationPotential misfolding of membrane or complex proteins
    Yeast (S. cerevisiae)Eukaryotic post-translational modificationsLower yield, more complex culture conditions
    Cell-free systemRapid, avoids toxicity issuesHigher cost, limited scale
    Cyanobacteria (native)Native folding environmentLower yield, more challenging purification
  • Purification strategy development:

    • Design a multi-step purification strategy incorporating affinity, ion exchange, and size exclusion chromatography

    • Include stabilizing agents based on predicted protein properties

    • Optimize buffer conditions through thermal shift assays or differential scanning fluorimetry

    • Implement quality control checkpoints using SDS-PAGE, Western blot, and mass spectrometry

  • Structural characterization:

    • Assess secondary structure through circular dichroism (CD) spectroscopy

    • Determine oligomerization state using size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Consider X-ray crystallography or cryo-electron microscopy for high-resolution structure determination

    • Implement hydrogen-deuterium exchange mass spectrometry to identify flexible regions and binding interfaces

  • Functional biochemical assays:

    • Design activity assays based on predicted function and structural features

    • If potential enzymatic activity is indicated, screen diverse substrates

    • Test interactions with predicted binding partners through surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC)

    • Evaluate potential DNA/RNA binding capacity through electrophoretic mobility shift assays (EMSA)

  • In vitro reconstitution of relevant pathways:

    • Based on hypothesized function, attempt reconstitution of metabolic or regulatory pathways in vitro

    • Include potential interaction partners or upstream/downstream pathway components

    • Monitor reaction progress using HPLC, mass spectrometry, or spectrophotometric assays

This comprehensive biochemical characterization approach follows strategies used for other Synechocystis proteins, such as Slr1293 (CrtD), where heterologous expression and in vitro biochemical assays successfully identified enzymatic function .

How can high-throughput phenotypic screening be applied to characterize slr1261 function?

To implement high-throughput phenotypic screening for slr1261 functional characterization, researchers should follow this systematic framework:

  • Library construction and validation:

    • Generate a library of slr1261 variants through random mutagenesis or domain-focused mutagenesis

    • Alternatively, construct a library of strains with varying levels of slr1261 repression using CRISPRi technology

    • Validate library diversity and coverage through next-generation sequencing

    • Include appropriate controls (wild-type, complete knockout) for benchmarking

  • Screening system development:

    • Design fluorescent or colorimetric reporters linked to relevant metabolic pathways or stress responses

    • Establish growth-based screening protocols under multiple selective conditions

    • Develop high-content imaging protocols for morphological phenotyping

    • Implement metabolite detection systems if specific biochemical pathways are targeted

  • High-throughput screening execution:

    • Perform parallel screening under multiple growth conditions to identify condition-specific phenotypes

    • Use microfluidic systems or automated liquid handling for consistent cell handling

    • Implement FACS-based enrichment for strains with desired reporter expression patterns

    • Consider competitive growth experiments to detect subtle fitness differences

  • Data analysis and hit validation:

    • Apply statistical methods to identify significant phenotypic deviations

    • Cluster variants based on phenotypic similarities across multiple conditions

    • Correlate sequence variations with phenotypic outcomes to identify functional domains

    • Validate top hits through targeted experiments and complementation studies

  • Functional category mapping:

    Screening ConditionPotential slr1261 FunctionDetection Method
    High light stressPhotoprotectionChlorophyll fluorescence, growth rate
    Oxidative stressRedox regulationROS-sensitive fluorescent dyes
    Carotenoid metabolismBiosynthetic enzymePigment extraction and HPLC
    Nutrient limitationRegulatory proteinGrowth rate, reporter gene expression
    Carbon fixationMetabolic enzymeIsotope incorporation, growth rate

This high-throughput approach builds upon successful strategies employed in Synechocystis, including pooled CRISPRi screening methods that have identified novel gene functions and phenotypes under diverse growth conditions .

What are the considerations for studying potential interactions between slr1261 and other regulatory proteins in Synechocystis?

When investigating interactions between slr1261 and other regulatory proteins in Synechocystis, implement this comprehensive methodological framework:

  • Bioinformatic prediction of interaction partners:

    • Perform co-expression analysis across multiple datasets to identify genes with similar expression patterns

    • Search for conserved protein domains associated with protein-protein interactions

    • Analyze genomic context conservation across cyanobacterial species

    • Apply computational prediction tools for protein-protein interactions

  • In vivo interaction validation approaches:

    • Implement bacterial two-hybrid or split-protein complementation assays

    • Perform co-immunoprecipitation with tagged slr1261 followed by mass spectrometry

    • Use proximity-dependent biotin labeling (BioID or APEX) to identify proteins in close proximity to slr1261

    • Consider fluorescence resonance energy transfer (FRET) for detecting direct interactions in vivo

  • Functional validation of interactions:

    • Create double mutants of slr1261 and predicted interaction partners

    • Analyze epistatic relationships through phenotypic characterization

    • Perform transcriptomic analysis of single and double mutants to identify shared regulatory targets

    • Implement synthetic genetic array analysis for genome-wide interaction mapping

  • Structural characterization of interaction interfaces:

    • Perform deletion and point mutation analysis to identify critical interaction domains

    • Consider protein docking simulations based on predicted structures

    • For confirmed interactions, pursue co-crystallization or cryo-EM structures of complexes

    • Apply hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • Regulatory network integration:

    • Map identified interactions onto known regulatory networks in Synechocystis

    • Look for enrichment of interaction partners in specific pathways or responses

    • Consider temporal dynamics of interactions under different environmental conditions

    • Develop predictive models of regulatory network function incorporating slr1261 interactions

This methodological approach parallels strategies used to characterize regulatory networks in Synechocystis, such as those involving the high-light responsive transcription factor RpaB and its extensive regulon, which influences photosynthetic electron transport and photoprotection mechanisms .

How can systems biology approaches be leveraged to place slr1261 within the broader metabolic network of Synechocystis?

To effectively position slr1261 within the metabolic network of Synechocystis using systems biology approaches, implement this integrated research framework:

  • Multi-omics data generation and integration:

    • Perform comparative transcriptomics (RNA-Seq) between wild-type and Δslr1261 strains

    • Implement proteomics to identify changes in protein abundance and post-translational modifications

    • Conduct metabolomics to detect altered metabolite pools and pathway activities

    • Apply fluxomics using isotope labeling to quantify changes in metabolic flux distribution

    • Integrate datasets using computational approaches to identify coordinated changes

  • Genome-scale metabolic model analysis:

    • Incorporate slr1261 and its potential functions into existing genome-scale models of Synechocystis

    • Perform flux balance analysis (FBA) to predict metabolic consequences of slr1261 deletion

    • Implement flux variability analysis to identify pathways most sensitive to slr1261 function

    • Validate model predictions through targeted experimental measurements

  • Network analysis and visualization:

    • Construct correlation networks based on multi-omics data

    • Identify modules and subnetworks affected by slr1261 deletion

    • Apply pathway enrichment analysis to characterize functional impacts

    • Visualize network perturbations using advanced network visualization tools

  • Comparative systems analysis across conditions:

    • Analyze network behavior under multiple environmental conditions (light intensity, nutrient availability, stress)

    • Identify condition-specific roles of slr1261 in network regulation

    • Compare network responses to slr1261 deletion with responses to other perturbations

    • Develop predictive models of condition-specific network behavior

  • Data integration table for systems-level analysis:

    Data TypeAnalysis ApproachExpected Insights
    TranscriptomicsDifferential expression, co-expression modulesRegulatory impacts, transcriptional networks
    ProteomicsProtein abundance changes, interaction networksPost-transcriptional effects, protein complexes
    MetabolomicsMetabolite profiling, pathway analysisAffected metabolic pathways, bottlenecks
    FluxomicsMetabolic flux analysis, flux balance analysisChanges in carbon flow, pathway utilization
    Network IntegrationMulti-omics data integration, network modelingEmergent properties, regulatory principles

This systems biology approach parallels successful strategies used to characterize the impact of environmental perturbations on Synechocystis metabolism, such as the integrated transcriptomic and metabolomic analysis of carbon supply shifts . The comprehensive framework allows for placement of slr1261 within the broader context of cellular metabolism and regulation, providing insights into both direct effects and system-wide consequences of its activity.

What are the most promising research directions for further characterizing slr1261 function?

Based on current understanding of cyanobacterial metabolism and regulation, these research directions offer the highest potential for revealing slr1261 function:

  • Integration with stress response networks:

    • Investigate potential roles in photoprotection and high-light acclimation, given the importance of these processes in cyanobacterial physiology

    • Examine possible connections to oxidative stress responses, particularly if structural features suggest redox-sensitive domains

    • Consider potential interactions with stress-responsive transcription factors like RpaB

  • Exploration of potential roles in carotenoid biosynthesis:

    • Investigate similarities with characterized carotenoid biosynthesis enzymes like Slr1293 (CrtD)

    • Analyze carotenoid profiles in slr1261 mutants under various growth conditions

    • Consider potential regulatory roles in controlling carotenoid biosynthesis rather than direct enzymatic functions

  • Investigation of carbon metabolism connections:

    • Explore potential links to carbon concentration mechanisms or carbon fixation

    • Analyze growth phenotypes under varying carbon availabilities

    • Consider roles in coordinating photosynthesis with carbon metabolism

  • Application of emerging technologies:

    • Implement CRISPRi-based approaches for tunable repression and phenotypic analysis

    • Apply genome-wide interaction screens to identify genetic partners

    • Utilize advanced imaging techniques to track protein localization and dynamics

  • Translational research opportunities:

    • Explore potential biotechnological applications based on revealed functions

    • Consider metabolic engineering applications if involved in valuable metabolic pathways

    • Investigate potential as a synthetic biology tool for controlling cyanobacterial metabolism

This roadmap for future research incorporates successful approaches used for other Synechocystis proteins and leverages the growing toolkit for cyanobacterial molecular biology. Prioritizing these directions will maximize the potential for significant discoveries regarding slr1261 function and its role in cyanobacterial physiology.

How should researchers address the potential challenges of functional redundancy when studying slr1261?

To effectively address functional redundancy challenges in slr1261 research, implement this comprehensive strategy:

  • Identification of potential redundant proteins:

    • Perform thorough sequence similarity searches to identify paralogs or functionally similar proteins

    • Conduct structural prediction to identify proteins with similar domain architecture

    • Analyze co-expression patterns to identify genes with complementary expression profiles

    • Consider phylogenetic distribution across cyanobacterial species to identify co-evolving gene families

  • Multi-knockout/knockdown experimental design:

    • Generate single and combinatorial mutants of slr1261 and potential redundant proteins

    • Implement inducible CRISPRi systems to create conditional knockdowns of essential genes

    • Design experiments to test graded levels of repression through tunable promoters

    • Apply competitive growth assays to detect subtle fitness effects in combinatorial mutants

  • Condition-dependent phenotypic analysis:

    • Test mutants under diverse environmental conditions to identify condition-specific functions

    • Focus on stress conditions that may reveal phenotypes masked under optimal growth

    • Implement high-throughput phenotyping approaches across multiple conditions

    • Consider temporal dynamics of phenotypes during acclimation to changing conditions

  • Systems-level analysis of compensation mechanisms:

    • Perform time-course transcriptomics following slr1261 deletion to identify compensatory responses

    • Analyze protein abundance changes that may reflect post-transcriptional compensation

    • Implement metabolic flux analysis to identify rerouting of metabolic pathways

    • Develop computational models of redundant networks to predict compensation mechanisms

  • Evolutionary context analysis:

    • Compare gene content across diverse cyanobacterial species to identify co-occurrence patterns

    • Analyze natural variation in slr1261 and related genes within Synechocystis populations

    • Consider horizontal gene transfer events that may have introduced functional redundancy

    • Reconstruct evolutionary history of gene families to identify duplication events

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.