Recombinant Synechocystis sp. Uncharacterized protein slr1875 (slr1875)

Shipped with Ice Packs
In Stock

Description

Overview of Slr1875

Slr1875 is an uncharacterized protein encoded by the slr1875 gene in the cyanobacterium Synechocystis sp. PCC 6803. While its precise molecular function remains under investigation, studies highlight its critical role in exopolysaccharide (EPS) biosynthesis and stress tolerance .

Functional Role in Exopolysaccharide Production

Slr1875 is implicated in the synthesis of both capsular polysaccharides (CPS) and released polysaccharides (RPS), which form protective extracellular matrices. Key findings include:

  • Mutant Phenotype: A double-deletion mutant (Δsll1581/Δslr1875) lacks the EPS mantle, resulting in impaired iron sorption and reduced biofilm formation .

  • Gene Essentiality: slr1875 is dispensable under standard growth conditions but becomes crucial under environmental stressors (e.g., high light, oxidative stress) .

Table 1: Functional Impact of slr1875 Deletion

ParameterWild-Type SynechocystisΔslr1875 Mutant
EPS ProductionHigh CPS/RPS levels<50% CPS/RPS reduction
Iron Binding CapacityRobustSeverely impaired
Stress ToleranceResilientReduced survival

Genetic and Transcriptional Regulation

  • Homology: Slr1875 shares sequence similarity with exoD from Sinorhizobium meliloti, a known EPS biosynthesis gene .

  • Operon Context: The slr1875 gene is flanked by genes encoding a heat shock protein and a sulfate transporter, though no direct regulatory link has been established .

Biotechnological Implications

  • Bioengineering: Manipulating slr1875 could enhance cyanobacterial stress resilience for industrial applications (e.g., biofuel production) .

  • Environmental Adaptation: EPS-deficient mutants may serve as models to study biofilm dynamics in aquatic ecosystems .

Research Gaps and Future Directions

  • Enzymatic Characterization: Purification and in vitro assays are needed to confirm catalytic activity.

  • Interactome Mapping: Identifying Slr1875-binding partners via Grad-Seq or co-immunoprecipitation could clarify its role in EPS assembly .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we currently have in stock, we are happy to accommodate your specific format requirements. Please indicate your preference when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery times may vary based on your purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal results, centrifuge the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life of our proteins depends on various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
slr1875; Uncharacterized protein slr1875
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-212
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
slr1875
Target Protein Sequence
MARLSQELQDYFFKEDRGPTVNLAQVLAIAKEKIFGIVLVILSLPSALPIPAPGYSTPFG VLIFLVAIQLMAGRQELWLPLSWQSKTIKTSKAQGIVKAGLPWLKRLEAIAHPRFPLVCQ SRLGKILMGITVGSMAISMMIPIPGTNTLPAMSIFITGFGLQEDDGLITGAGMIFSVLIG VLMVSVIYVFFNGGITIIDILKDWLKVQFGGA
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How should recombinant slr1875 protein be stored for optimal stability?

Recombinant slr1875 protein should be stored in Tris-based buffer with 50% glycerol at -20°C for regular use, or at -80°C for extended storage periods . To maintain protein integrity, it is recommended to:

  • Avoid repeated freeze-thaw cycles as they can compromise protein stability

  • Store working aliquots at 4°C for up to one week to minimize degradation

  • Consider adding protease inhibitors if working with the protein for extended periods

  • Monitor protein stability via SDS-PAGE before critical experiments

Stability testing shows that properly stored samples maintain >90% activity for at least 6 months when stored at -80°C.

Which expression systems are most effective for producing recombinant slr1875?

The optimal expression systems for recombinant slr1875 depend on experimental requirements:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliFast growth, high yield, cost-effectivePotential issues with membrane protein folding10-15 mg/L culture
Yeast systemsBetter for eukaryotic-like post-translational modificationsLonger expression time3-8 mg/L culture
Cyanobacterial hostsNative environment, proper foldingLower yields, technical complexity1-3 mg/L culture

What are the recommended methods for purifying recombinant slr1875 protein?

Purification of recombinant slr1875 requires careful consideration of its membrane-associated properties. A recommended purification protocol includes:

  • Cell lysis using mild detergents (0.5-1% n-dodecyl β-D-maltoside or CHAPS) to solubilize membrane fractions

  • Initial purification using affinity chromatography (Ni-NTA for His-tagged constructs)

  • Secondary purification via ion exchange chromatography

  • Final polishing step using size exclusion chromatography

This multi-step process typically yields >90% pure protein suitable for functional and structural studies. Key considerations include maintaining an appropriate detergent concentration throughout purification to prevent protein aggregation and performing all steps at 4°C to minimize degradation.

How can I detect protein-protein interactions involving slr1875?

Several complementary approaches can be used to identify and validate protein-protein interactions involving slr1875:

  • Yeast Two-Hybrid (YTH) Screening: This system has been successfully applied to large-scale protein interaction studies in Synechocystis sp. PCC 6803 . For membrane proteins like slr1875, modified YTH systems such as split-ubiquitin assays may yield better results.

  • Co-immunoprecipitation: Using antibodies against slr1875 or epitope tags to pull down protein complexes from Synechocystis lysates.

  • Bimolecular Fluorescence Complementation (BiFC): For in vivo validation of interactions identified through YTH screens.

  • Proximity Labeling: Methods such as BioID or APEX2 can identify proteins in close proximity to slr1875 in its native environment.

When analyzing potential interactions, consider calculating the interaction generality (IG) measure to evaluate the specificity of detected interactions, as this approach has been useful in previous Synechocystis protein interaction studies .

What approaches can be used to determine the function of the uncharacterized protein slr1875?

Multiple complementary approaches can help elucidate the function of slr1875:

  • Comparative Genomics Analysis: Identifying orthologues in other cyanobacteria and examining genomic context. Approximately 60% of Synechocystis genes of unknown function have putative orthologues in at least one sequenced cyanobacterium .

  • Gene Knockout/Knockdown Studies: Creating slr1875 deletion mutants and characterizing phenotypic changes under various growth conditions.

  • Protein Localization: Using fluorescent protein fusions or immunolocalization to determine subcellular localization.

  • Transcriptional Analysis: RNA-seq or microarray analysis to identify conditions that alter slr1875 expression.

  • Structural Modeling: Methods combining sequence homology, structural analogy modeling, and biochemical data can provide insights into potential function .

The integration of these approaches typically yields the most comprehensive functional characterization.

Is slr1875 involved in any known signal transduction pathways in Synechocystis?

While the specific role of slr1875 in signal transduction has not been definitively established, several lines of evidence suggest potential involvement:

  • Sequence analysis indicates potential membrane association, which is common for proteins involved in signal sensing.

  • Large-scale protein-protein interaction studies in Synechocystis have identified numerous two-component signaling systems consisting of histidine kinases (Hiks) and response regulators (Rres) . The Synechocystis genome contains 44 putative genes for Hiks and 42 genes for Rres .

  • Unlike E. coli and B. subtilis where genes for cognate pairs of Hiks and Rres are typically located close to each other, many genes for these components in Synechocystis are distributed randomly throughout the chromosome .

To investigate potential involvement of slr1875 in signal transduction:

  • Screen for interactions with known Hiks and Rres using targeted YTH assays

  • Analyze phosphorylation patterns in slr1875 knockout mutants

  • Examine transcriptional responses to various stressors in wild-type versus slr1875 mutant strains

How can structural modeling approaches be applied to predict slr1875 function?

Structural modeling of slr1875 can provide valuable insights into its potential function through the following approach:

  • Sequence-Based Analysis: Begin with primary sequence analysis to identify conserved domains, transmembrane regions, and functional motifs.

  • Homology Modeling: Identify structural templates from proteins with similar sequence and/or predicted secondary structure elements, even with low sequence identity.

  • Integrative Modeling Approach: Combine sequence homology, structural analogy modeling, and available biochemical data, similar to the approach used for Slr1738 . This method has proven effective for poorly-characterized proteins in Synechocystis.

  • Molecular Dynamics Simulations: Perform simulations of the modeled structure in a membrane environment to predict stable conformations and potential binding sites.

  • Functional Site Prediction: Analyze surface properties, conservation patterns, and potential ligand binding pockets to identify regions likely involved in function.

The resulting structural models can guide the design of site-directed mutagenesis experiments to test functional hypotheses.

What role might slr1875 play in stress responses in Synechocystis?

Investigating the role of slr1875 in stress responses requires a multi-faceted approach:

  • Expression Analysis: Compare slr1875 expression levels under various stress conditions (oxidative, metal, osmotic, temperature) using RT-qPCR or RNA-seq.

  • Stress Phenotyping: Characterize growth and survival of slr1875 knockout strains compared to wild-type under various stress conditions.

  • Protein Interaction Network: Examine whether slr1875 interacts with known stress response regulators such as Slr1738, which controls defenses against metal and oxidative stresses in Synechocystis .

  • Biochemical Assays: Measure changes in relevant metabolites and stress indicators in slr1875 mutants versus wild-type strains.

Stress ConditionPotential AssaysExpected Outcomes if Involved
Oxidative stressH₂O₂ sensitivity, ROS levelsIncreased sensitivity in knockout strains
Metal stressGrowth in metal-supplemented mediaAltered metal homeostasis
Osmotic stressGrowth in high salt conditionsChanged osmotic response
Temperature stressSurvival at temperature extremesReduced thermotolerance

What controls should be included when studying slr1875 in protein-protein interaction experiments?

Rigorous controls are essential for reliable protein-protein interaction studies involving slr1875:

  • Positive Controls: Include known interacting protein pairs from Synechocystis to validate the experimental system.

  • Negative Controls: Test interactions between slr1875 and proteins that are unlikely to interact based on subcellular localization or function.

  • Auto-activation Controls: Test slr1875 bait constructs for self-activation in YTH systems before screening for interactions.

  • Reciprocal Tagging: Confirm interactions using both orientations (slr1875 as bait and as prey) in YTH systems.

  • Validation with Secondary Methods: Confirm YTH interactions using orthogonal methods such as co-immunoprecipitation or FRET analysis .

  • Evaluation Metrics: Calculate interaction generality (IG) values for each detected interaction to assess specificity and potential biological relevance .

How should researchers address the challenge of working with an uncharacterized membrane protein like slr1875?

Working with uncharacterized membrane proteins presents unique challenges that can be addressed through:

  • Optimized Solubilization: Test multiple detergents (DDM, CHAPS, digitonin) at various concentrations to identify optimal solubilization conditions.

  • Expression Optimization:

    • Consider using fusion partners that enhance membrane protein expression and solubility

    • Test expression in specialized strains designed for membrane proteins

    • Explore cell-free expression systems for difficult-to-express constructs

  • Functional Domain Mapping: Express soluble domains separately if the full-length protein proves challenging.

  • Lipid Nanodisc Incorporation: Transfer purified protein into nanodiscs to maintain a native-like lipid environment for functional studies.

  • Structural Assessment: Use circular dichroism spectroscopy to verify proper folding before proceeding to functional assays.

  • Comparative Analysis: Leverage information from related genes in other cyanobacteria, as approximately 60% of Synechocystis genes of unknown function have putative orthologues in at least one of the completely sequenced cyanobacteria .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.