Recombinant Synechocystis sp. Uncharacterized transporter sll1263 (sll1263)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Properties

Recombinant Sll1263 is a transmembrane protein expressed in E. coli for experimental studies. Key properties include:

PropertyDetail
UniProt IDP74068
Expression SystemE. coli (in vitro)
TagN-terminal 10×His tag
Molecular Weight~35 kDa (full-length protein spanning 310 amino acids)
Storage Conditions-20°C for extended storage; avoid repeated freeze-thaw cycles

Functional Role in Iron Homeostasis

Sll1263 is essential for iron acquisition under deficiency:

  • Iron Uptake Mechanism: Unlike bacterial CDF proteins (e.g., FieF), Sll1263 facilitates Fe²⁺ import into cells, critical for photosynthetic machinery .

  • Gene Regulation: sll1263 expression is induced under iron-deficient conditions, while its inactivation reduces cellular iron content by ~40% .

  • Mutant Phenotype:

    • sll1263⁻ mutants exhibit stunted growth under low iron .

    • Compensatory upregulation of other iron transporters (e.g., futA1, feoB) occurs even in iron-replete conditions .

Table 1: Comparative Analysis of Wild-Type vs. sll1263⁻ Mutant

ParameterWild-Typesll1263⁻ MutantSource
Growth Rate (Low Fe)NormalReduced by 60%
Cellular Iron Content0.35 µmol Fe/mg protein0.21 µmol Fe/mg protein
Iron Uptake Rate8.2 nmol Fe/min/mg3.1 nmol Fe/min/mg
Expression of futA1Baseline12-fold increase

Overexpression Effects:

  • Enhances growth under iron deficiency but causes toxicity in high-iron environments .

  • Complementation with native Sll1263 restores wild-type iron uptake, but heterologous FieF fails .

Evolutionary and Ecological Implications

The unique iron-uptake function of Sll1263 likely evolved due to:

  • High Iron Demand: Cyanobacteria require iron for photosynthesis and nitrogen fixation .

  • Low-Iron Habitats: Marine and freshwater environments where Synechocystis thrives often have Fe concentrations <1 nM .

Applications in Biotechnology

  • Biofertilizers: Engineering crops with Sll1263 could improve iron uptake in iron-poor soils.

  • Bioremediation: Potential use in iron-scavenging systems for environmental cleanup.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
sll1263; Uncharacterized transporter sll1263
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
sll1263
Target Protein Sequence
MTARLARPYAVLSIGAALATMGLKLGAYAITGSVGLLSDALESTVNLASAIVAFWALSLA ATPADSEHPFGHSKAEYFSSGLEGAFIFVAALGIGYSAVERLLSPRPLDQNALGIALAIA ATALNGTVAWILWRAGKRLNSIALRADSQHLMTDVWTSVGVVVAVALIFVTGWEWLDPLI ALGVGFNVLWTGTHLLRETISSLMDQSLPPAQLQAITSCFLPYEDQGVRFHLLQTRQAGS QSFISFHVLVPGHWTVQRGHDLCEAIETAIAERITGSRVTTHLEPLEDPKSWQHPDEFPP SAPLNRDKPN
Uniprot No.

Target Background

Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is sll1263 and what is its fundamental role in Synechocystis sp. PCC 6803?

Sll1263 is a cation diffusion facilitator (CDF) protein encoded by the gene sll1263 in the cyanobacterium Synechocystis sp. strain PCC 6803. Unlike typical CDF proteins that function in metal efflux, sll1263 plays a critical role in iron uptake. The protein is essential for the organism's survival under iron-deficient conditions, as demonstrated by growth deficiencies in sll1263-deficient mutants. The gene product shows approximately 50% amino acid similarity with ferrous iron efflux protein (FieF) found in heterotrophic bacteria, yet exhibits functionally distinct properties with respect to iron transport direction .

To study this protein, researchers typically employ gene knockout and complementation experiments to assess phenotypic changes related to iron metabolism. Measurements of cellular iron content and uptake rates can be performed using radioactive iron isotopes (55Fe or 59Fe) or through inductively coupled plasma mass spectrometry (ICP-MS) analysis.

How does the expression of sll1263 respond to environmental iron conditions?

The expression of sll1263 is highly responsive to environmental iron levels, with significant upregulation observed under iron-deficient conditions. This inducible expression pattern suggests a tightly regulated system that responds to cellular iron needs. When wild-type Synechocystis is subjected to iron limitation, sll1263 transcription increases substantially, presumably to enhance iron acquisition capacity .

Methodology for studying expression changes includes:

  • Quantitative RT-PCR to measure transcript levels

  • Reporter gene fusions (e.g., with luciferase or GFP) to visualize expression patterns

  • RNA-seq for genome-wide expression analysis

  • Western blotting with specific antibodies to detect protein levels

What phenotypic changes occur when sll1263 is genetically modified?

Genetic modification of sll1263 produces distinct phenotypes related to iron metabolism:

Genetic ModificationGrowth in Fe-deficient conditionsGrowth in Fe-sufficient conditionsGrowth in high-Fe conditionsIron uptake rateCellular iron content
Wild-typeNormalNormalNormalBaselineBaseline
sll1263(-) mutantSignificantly decreasedSlightly decreasedNormalSignificantly lowerSignificantly lower
sll1263 overexpressionEnhancedNormalReducedHigherHigher
FieF complementation in sll1263(-) mutantNo rescue of Fe-deficient phenotypeNo changeNo changeLowLow
Sll1263 complementation in sll1263(-) mutantComplete restorationNormalNormalRestored to normalRestored to normal

These phenotypic observations strongly support the role of sll1263 in iron uptake rather than detoxification or efflux. The inability of FieF (the heterotrophic bacterial homolog) to rescue the Fe-deficient phenotype in the sll1263(-) mutant highlights the functional divergence between these related proteins .

What is the proposed mechanism for sll1263's role in iron uptake?

Unlike conventional CDF proteins that typically export metals from cells, sll1263 functions in iron acquisition. The exact molecular mechanism remains incompletely characterized, but several hypotheses have been proposed:

  • Altered transmembrane domain configuration: The transmembrane domains of sll1263 may have evolved specific amino acid substitutions that reverse the direction of transport, enabling iron influx rather than efflux.

  • Modified energy coupling: The protein may couple to different ion gradients compared to typical CDFs, potentially utilizing proton or sodium gradients to drive iron uptake rather than export.

  • Integration with specialized cyanobacterial iron acquisition systems: Sll1263 might function in concert with other iron transporters or siderophore-based systems specific to cyanobacteria.

Research methodologies to elucidate these mechanisms include:

  • Proteoliposome-based transport assays to measure substrate:ion stoichiometries

  • Application of specific membrane potential (Δψ) or pH (ΔpH) gradients to determine if transport is electroneutral or electrogenic

  • Mutagenesis of putative metal-binding residues followed by functional characterization

  • Counterflow transport experiments to assess substrate binding and transport directionality

How might the structure of sll1263 explain its unique function?

While no high-resolution structure of sll1263 has been reported in the provided search results, structural insights can be inferred through comparative analysis with other transporters and experimental approaches:

  • Homology modeling: Using structures of related CDF proteins as templates to predict sll1263's conformation

  • Structural stabilization methods:

    • Thermostability assays (e.g., CPM or GFP-TS) to identify conditions that stabilize the protein

    • Conformational thermostabilization approaches to lock the protein in specific states

    • Potential complex formation with antibody fragments (Fabs) to aid structural determination

  • Potential structural determination approaches:

    • X-ray crystallography of purified protein

    • Single-particle cryo-EM (though challenging due to the relatively small size of MFS transporters)

    • Fluorescence-detection size exclusion chromatography (FSEC) to assess protein stability

Research on sll1263's structure would need to overcome the typical challenges associated with membrane protein structural biology, including protein purification in detergents or lipid mimetics that maintain native conformation.

How does sll1263 interact with other iron acquisition systems in Synechocystis?

In the sll1263(-) mutant, other genes known to be required for iron acquisition were strongly upregulated even in the presence of high iron concentrations . This compensatory response suggests:

  • The existence of a regulatory network that senses cellular iron status and coordinates expression of multiple iron acquisition systems

  • Potential functional overlap or complementarity between sll1263 and other iron transporters

  • A hierarchical arrangement of iron acquisition mechanisms with sll1263 potentially serving as a primary or high-affinity system

Methodological approaches to investigate these interactions include:

  • Global transcriptomic analysis of wild-type vs. sll1263(-) mutant strains under varying iron conditions

  • Protein-protein interaction studies (co-immunoprecipitation, FRET, etc.) to identify physical interactions between sll1263 and other transport or regulatory proteins

  • Double or triple knockout studies to assess functional redundancy or synergy between different iron acquisition systems

  • Radiolabeled iron uptake studies in the presence of specific inhibitors of other transport systems

What evolutionary insights can be gained from studying sll1263?

The functional divergence between sll1263 and its homologs in heterotrophic bacteria offers a fascinating case study in protein evolution and adaptation:

  • Functional reversal: Evolution has apparently reversed the direction of metal transport in sll1263 compared to conventional CDF proteins like FieF. This represents a significant functional shift within a conserved protein family.

  • Environmental adaptation: The reversal in function likely reflects adaptation to the unique ecological challenges faced by cyanobacteria - specifically their high iron requirements for photosynthetic apparatus combined with frequent exposure to iron-limited aquatic environments .

  • Comparative evolutionary analysis: Comparison of sll1263 sequences across diverse cyanobacterial species could reveal the timing and sequence of adaptations that led to the functional shift from metal efflux to uptake.

Research approaches would include:

  • Phylogenetic analysis of CDF proteins across bacterial lineages

  • Identification of conserved vs. divergent amino acid residues between cyanobacterial and heterotrophic bacterial CDF proteins

  • Experimental evolution studies under varying iron selective pressures

  • Domain swapping or site-directed mutagenesis to identify specific regions responsible for the functional divergence

What are the recommended approaches for characterizing iron transport mediated by sll1263?

Several complementary approaches can be employed to characterize iron transport:

  • Whole-cell transport assays: Measuring uptake of radiolabeled iron (55Fe or 59Fe) in wild-type, mutant, and complemented strains under varying conditions. This approach provides physiologically relevant data but may be influenced by other iron transport systems.

  • Proteoliposome-based assays: Reconstituting purified sll1263, with or without mutations, into liposomes and measuring substrate transport. This system allows for precise control of:

    • Internal and external buffer composition

    • Membrane potential (Δψ) and pH gradient (ΔpH)

    • Substrate and ion concentrations

  • Counterflow transport: Preloading proteoliposomes with high concentrations of unlabeled substrate, then diluting into a buffer containing radiolabeled substrate. This approach can distinguish between complete transport cycle defects and specific steps in the transport mechanism .

  • Electrophysiology: Patch-clamp recordings of sll1263 activity in reconstituted systems to measure ion currents associated with transport.

  • Substrate binding assays: Using techniques such as isothermal titration calorimetry (ITC), microscale thermophoresis (MST), or surface plasmon resonance (SPR) to measure direct binding of iron or other potential substrates to purified sll1263.

What expression systems are most suitable for producing recombinant sll1263 for biochemical and structural studies?

The choice of expression system for membrane proteins like sll1263 is critical for obtaining sufficient quantities of properly folded protein:

  • Prokaryotic systems:

    • E. coli: Most common and straightforward, but may not provide native-like membrane environment

    • Native cyanobacterial expression: Maintains natural membrane composition but typically yields lower protein amounts

    • Other bacteria (Lactococcus, Bacillus): May offer advantages for specific membrane proteins

  • Eukaryotic systems:

    • Yeast (S. cerevisiae, P. pastoris): Often yield higher amounts of properly folded membrane proteins

    • Insect cells: Excellent for complex membrane proteins but more expensive and technically demanding

    • Mammalian cells: Highest likelihood of proper folding but most costly and complex

For sll1263 specifically, research approaches would include:

  • Testing multiple expression systems in parallel

  • Optimization of induction conditions, temperature, and duration

  • Use of fusion tags (e.g., GFP) to monitor expression and folding

  • Assessment of protein stability using techniques like FSEC or the GFP-TS assay

  • Screening different detergents for efficient extraction and stability

How can researchers assess the stability and functionality of purified sll1263?

Several complementary approaches can be used to evaluate protein quality:

  • Thermal stability assays:

    • CPM (N-[4-(7-diethylamino-4-methyl-3-coumarinyl)phenyl]maleimide) assay: Monitors protein unfolding through exposure of buried cysteine residues

    • GFP-TS assay: For GFP-tagged proteins, monitors heat-induced aggregation through fluorescence retention

  • Ligand binding studies:

    • Thermal shift assays in the presence vs. absence of potential substrates

    • Direct binding measurements using ITC, MST, or SPR

    • Fluorescence-based binding assays with labeled ligands

  • Functional reconstitution:

    • Transport assays in proteoliposomes

    • Counterflow transport measurements

    • Assessment of electrophysiological properties

  • Structural characterization:

    • Circular dichroism to evaluate secondary structure content

    • Limited proteolysis to assess conformational flexibility

    • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to determine oligomeric state

How should researchers interpret conflicting results between different iron transport assay methods?

When faced with seemingly contradictory results from different experimental approaches, consider:

  • Assay-specific limitations:

    • Whole-cell assays measure net effect across all transport systems

    • Reconstituted systems may lack important cellular cofactors or interacting proteins

    • Different pH or ion conditions may alter transport directionality

  • Methodological approach:

    • Systematically vary experimental conditions across methods to identify variables causing discrepancies

    • Perform control experiments with known transporters of similar families

    • Consider the presence of other metals that might compete with iron

  • Protein state considerations:

    • Verify protein orientation in reconstituted systems

    • Assess oligomeric state and its potential impact on function

    • Consider post-translational modifications that might be present in vivo but absent in recombinant systems

The transport mechanism of sll1263 may involve complex coordination with other cellular components, so discrepancies between simplified in vitro systems and whole-cell measurements could provide valuable mechanistic insights rather than simply representing experimental error.

What are common pitfalls in studying iron transport in cyanobacteria?

Several challenges are particularly relevant to studying iron transport in cyanobacteria:

  • Iron speciation:

    • Fe(II) vs. Fe(III) oxidation states have different solubility and transport properties

    • Redox conditions in experimental buffers may alter iron speciation

    • Light can influence iron redox chemistry, particularly in photosynthetic organisms

  • Metal contamination:

    • Trace metal contamination in buffers or glassware can significantly impact results

    • Special "metal-free" techniques may be required for accurate measurements

    • Competitive effects from other divalent cations should be controlled

  • Physiological complexity:

    • Cyanobacteria may utilize multiple iron acquisition systems simultaneously

    • Iron storage systems can buffer cellular responses to external iron changes

    • Photosynthetic activity creates unique redox environments that influence iron chemistry

  • Technical considerations:

    • Maintaining viable and physiologically relevant cyanobacterial cultures

    • Accounting for potential light effects on experimental measurements

    • Ensuring complete cell lysis for accurate cellular iron content measurements

How can researchers differentiate between direct and indirect effects of sll1263 mutations?

Distinguishing direct from indirect effects requires multiple lines of evidence:

  • Complementation studies:

    • Re-expression of wild-type sll1263 should restore normal phenotype

    • Expression of homologs (like FieF) can reveal functional specificity

    • Domain swap or chimeric proteins can identify critical functional regions

  • Point mutations vs. complete knockout:

    • Specific point mutations affecting key residues may disrupt particular functions while preserving others

    • Comparison with complete gene deletion can distinguish partial from complete loss of function

  • Immediate vs. long-term effects:

    • Acute measurements (e.g., rapid transport assays) are more likely to reflect direct effects

    • Long-term growth phenotypes may involve complex adaptive responses

    • Time-course experiments can help distinguish primary from secondary effects

  • In vitro confirmation:

    • Direct demonstration of transport activity with purified protein in reconstituted systems

    • Binding assays to confirm direct interaction with substrates

    • Structural studies to identify conformational changes associated with transport

What are promising approaches for elucidating the structure of sll1263?

Future structural studies of sll1263 could employ:

  • Protein engineering strategies:

    • Thermostabilizing mutations to lock the protein in specific conformational states

    • Fusion with crystallization chaperones or scaffold proteins

    • Creation of antibody fragments (Fabs) to aid crystallization or cryo-EM studies

  • Advanced structural techniques:

    • Single-particle cryo-EM with improvements in detector technology for smaller proteins

    • Microcrystal electron diffraction (MicroED) for small crystals

    • XFEL (X-ray free-electron laser) crystallography for time-resolved structures

  • Hybrid approaches:

    • Integrating computational modeling with experimental restraints from EPR, crosslinking, or HDX-MS

    • Hydrogen-deuterium exchange mass spectrometry to map conformational dynamics

    • Single-molecule FRET to track conformational changes during transport cycle

A high-resolution structure would significantly advance understanding of sll1263's unique transport mechanism and evolutionary adaptation .

How might genetic engineering of sll1263 enhance cyanobacterial iron uptake for biotechnological applications?

While avoiding commercial applications, academic research on enhancing iron uptake could focus on:

  • Rational design approaches:

    • Structure-guided mutations to increase transport efficiency

    • Modifications to alter substrate specificity or regulatory properties

    • Fine-tuning expression patterns for optimal iron homeostasis

  • Directed evolution strategies:

    • Development of selection systems for enhanced iron uptake

    • High-throughput screening of sll1263 variants under iron-limited conditions

    • Evolution of chimeric transporters combining features from multiple iron transport systems

  • Synthetic biology implementation:

    • Integration of optimized sll1263 variants into minimal synthetic systems

    • Creation of iron-responsive genetic circuits incorporating sll1263

    • Coupling enhanced iron uptake to specific metabolic pathways of interest

These approaches could advance fundamental understanding of transport mechanisms while developing tools for studying iron metabolism in photosynthetic systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.